BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_G18 (512 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 33 0.085 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 31 0.34 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 31 0.46 At3g56600.1 68416.m06294 phosphatidylinositol 3- and 4-kinase fa... 31 0.46 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 30 1.1 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 29 1.4 At3g57630.2 68416.m06421 exostosin family protein contains Pfam ... 29 1.4 At3g57630.1 68416.m06420 exostosin family protein contains Pfam ... 29 1.4 At5g01950.1 68418.m00114 leucine-rich repeat transmembrane prote... 29 2.4 At3g26720.1 68416.m03341 glycosyl hydrolase family 38 protein si... 29 2.4 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 29 2.4 At3g13490.1 68416.m01697 tRNA synthetase class II (D, K and N) f... 29 2.4 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 28 3.2 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 28 3.2 At3g59550.1 68416.m06646 cohesion family protein SYN3 (SYN3) nea... 28 3.2 At1g64140.1 68414.m07266 expressed protein similar to putative d... 28 3.2 At1g15190.1 68414.m01816 hypothetical protein 28 3.2 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 28 4.2 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 27 5.6 At5g09670.2 68418.m01119 loricrin-related contains weak similari... 27 5.6 At5g09670.1 68418.m01118 loricrin-related contains weak similari... 27 5.6 At3g15820.1 68416.m02002 phosphatidic acid phosphatase-related /... 27 5.6 At3g07440.1 68416.m00887 expressed protein 27 5.6 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 27 5.6 At1g26150.1 68414.m03192 protein kinase family protein similar t... 27 5.6 At5g64550.1 68418.m08112 loricrin-related contains weak similari... 27 7.4 At5g60930.1 68418.m07643 chromosome-associated kinesin, putative... 27 7.4 At5g22010.1 68418.m02561 AAA-type ATPase family protein / BRCT d... 27 7.4 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 27 7.4 At4g29310.1 68417.m04190 expressed protein 27 7.4 At2g44790.1 68415.m05574 uclacyanin II strong similarity to ucla... 27 7.4 At5g18370.1 68418.m02161 disease resistance protein (TIR-NBS-LRR... 27 9.8 At3g58860.1 68416.m06560 F-box family protein contains F-box dom... 27 9.8 At3g10650.1 68416.m01281 expressed protein 27 9.8 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 33.5 bits (73), Expect = 0.085 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = -3 Query: 459 SRCTPAFPCKSRSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 319 SR P + R RGG RG GRGRG G + P+ +S Sbjct: 223 SRRLPIHNQQGGGMRGGRGGFRARGRGNGGRGRGGGRGNGKKPVEKS 269 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 31.5 bits (68), Expect = 0.34 Identities = 40/139 (28%), Positives = 56/139 (40%), Gaps = 2/139 (1%) Frame = -3 Query: 432 KSRST-RSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRSR*SLCTPCA*SRFRMDTP*CS 256 KSRST +S+ +PR S R S + R ++ R + +P R R +P Sbjct: 235 KSRSTSQSSDASISPRKRRLSNSRRRSRSRSVRRSLSPRRRRIHSPF---RSRSRSP--- 288 Query: 255 CR*LPRAR*SHRHGRRCS-ALSCTDRQD*FHCQEHRVTHSGSRRHELSQPPGIVSRPGSP 79 + R R GRR S A S R + R +RR PP R +P Sbjct: 289 ---IRRHRRPTHEGRRQSPAPSRRRRSPSPPARRRRSPSPPARRRRSPSPPARRHRSPTP 345 Query: 78 PCRSRGAPTRRCPRGEAPP 22 P R R +P+ R +PP Sbjct: 346 PARQRRSPSPPARRHRSPP 364 Score = 28.7 bits (61), Expect = 2.4 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = -3 Query: 153 RVTHSGSRRHELSQPPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSA 13 R + + SRR PP R SPP R R +P+ R +P A Sbjct: 301 RQSPAPSRRRRSPSPPARRRRSPSPPARRRRSPSPPARRHRSPTPPA 347 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -3 Query: 162 QEHRVTHSGSRRHELSQPPGIVSRPGSPPCRSRGAPTRRCPRGEAP 25 ++ R +RRH S PP R SPP R R +P+ R +P Sbjct: 348 RQRRSPSPPARRHR-SPPPARRRRSPSPPARRRRSPSPPARRRRSP 392 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 135 SRRHELSQPPGIVSRPGSPPCRSRGAPTRRCPRGEAP 25 +RR PP R SPP R R +P+ R +P Sbjct: 366 ARRRRSPSPPARRRRSPSPPARRRRSPSPLYRRNRSP 402 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 31.1 bits (67), Expect = 0.46 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 362 LPRPLGAVPRGAVPPRADRVLRDLQGNAGVQRERNVRLPAAH 487 LPRP+ P G +PP + + + G+ G+Q N ++ +H Sbjct: 608 LPRPMQMPPHGHMPPPSMPMSHQMPGSMGMQGGMNPQMSQSH 649 >At3g56600.1 68416.m06294 phosphatidylinositol 3- and 4-kinase family protein low similarity to 55 kDa type II phosphatidylinositol 4-kinase [Rattus norvegicus] GI:13660755; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 533 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = -2 Query: 379 SEWSRQRQRCRYTSQSDDQVSLKFVHTLRLESVSYGHSLMQLQIASPCSLIS 224 S++SR QRCR S ++ + +T + + HSL +++PC IS Sbjct: 13 SQFSRSSQRCRLQSLTNLDFNFLGFNTKQTNLSASSHSLNNRSVSTPCFSIS 64 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 29.9 bits (64), Expect = 1.1 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +2 Query: 8 GAADVGGASPRGHLRVGAPRERHGGEPGRETIPGG*E-SSCLRDPE*VTRCS 160 G +GG P G G P GG PG +PGG + S L DPE +T S Sbjct: 349 GMPGMGGGMPAGMGGGGMPGAG-GGMPGGGGMPGGMDFSKILNDPELMTAFS 399 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 111 PPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAAP 7 PP + PGSPP S P+ P +PPT + P Sbjct: 536 PPSTPTSPGSPPSPSSPTPSSPIP---SPPTPSTP 567 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 111 PPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAAP 7 PP PGSPP +PT P G P + P Sbjct: 458 PPSTTPSPGSPPT----SPTTPTPGGSPPSSPTTP 488 >At3g57630.2 68416.m06421 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 791 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Frame = +3 Query: 144 ESRDAPDNEINLDDPC-MKVHCSAGRVCEINEHGEAICNCIKECPYETDSRRKVCTNFNE 320 + DA ++ + + C K C GR CEI C C+ +C R C Sbjct: 240 DPEDAYAMKVKIKEECDCKYDCLWGRFCEIPVQ----CTCVNQCSGHGKCRGGFCQCDKG 295 Query: 321 TWSSDCEV 344 + +DC + Sbjct: 296 WFGTDCSI 303 >At3g57630.1 68416.m06420 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 793 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Frame = +3 Query: 144 ESRDAPDNEINLDDPC-MKVHCSAGRVCEINEHGEAICNCIKECPYETDSRRKVCTNFNE 320 + DA ++ + + C K C GR CEI C C+ +C R C Sbjct: 242 DPEDAYAMKVKIKEECDCKYDCLWGRFCEIPVQ----CTCVNQCSGHGKCRGGFCQCDKG 297 Query: 321 TWSSDCEV 344 + +DC + Sbjct: 298 WFGTDCSI 305 >At5g01950.1 68418.m00114 leucine-rich repeat transmembrane protein kinase, putative receptor protein kinases Length = 1032 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -2 Query: 184 SSRLISLSGASRDSFRISETRALSASWNRLSSRLSAMPFSR 62 S R SL GA D +I + L SWN L+ + + FS+ Sbjct: 334 SLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSK 374 >At3g26720.1 68416.m03341 glycosyl hydrolase family 38 protein similar to lysosomal alpha-mannosidase GI:3522867 from [Homo sapiens] Length = 1019 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 63 LENGMAESLDERRFQEAERARVSEILNESRDAPD 164 LENG E + RR Q + V EILNE+ P+ Sbjct: 794 LENGQIELMLHRRMQHDDIRGVGEILNETVCLPE 827 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -3 Query: 135 SRRHELSQPPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAAP 7 ++ H +PP IV P PP + PT+ P PPT+ P Sbjct: 106 TKPHPHPKPP-IVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPP 147 >At3g13490.1 68416.m01697 tRNA synthetase class II (D, K and N) family protein similar to SP|Q9RHV9 Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase) {Bacillus stearothermophilus}; contains Pfam profile: PF00152 tRNA synthetases class II (D, K and N) Length = 602 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 450 TPAFPCKSRSTRSARGGTAPRGTAPSGRGRGSA 352 +PA C S ++ S+ T + PSGR R SA Sbjct: 40 SPALRCASAASSSSSSATTAETSKPSGRNRRSA 72 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 426 RSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 319 RS+ ARG + RG GRG G G R P RS Sbjct: 85 RSSHDARGSYSGRGRG--GRGGGDGGGRERGPSRRS 118 Score = 27.9 bits (59), Expect = 4.2 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -3 Query: 495 SRACAAGSLTFRSRCTPAFPCKSRS-TRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 319 SR+ + G +SR P +SRS +RS +P+ A S R R A T RSP +RS Sbjct: 199 SRSPSRGRSYSKSRSRGRSPSRSRSRSRSRSKSRSPK--AKSLR-RSPAKSTSRSPRSRS 255 Query: 318 R 316 R Sbjct: 256 R 256 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 28.3 bits (60), Expect = 3.2 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 426 RSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRS 319 RS+ ARG + RG GRG G G R P RS Sbjct: 85 RSSHDARGSYSGRGRG--GRGGGDGGGRERGPSRRS 118 >At3g59550.1 68416.m06646 cohesion family protein SYN3 (SYN3) nearly identical to cohesion family protein SYN3 [Arabidopsis thaliana] GI:12006362; supporting cDNA gi|12006361|gb|AF281155.1|AF281155 Length = 693 Score = 28.3 bits (60), Expect = 3.2 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +3 Query: 3 TTERPTSAGLPRGDISESEHLENGMAESLDERRFQEAERARVSEILNESRDAPDNEINL 179 ++ PT++ P GD+S SE L G L R F E + +++ +D P +I L Sbjct: 624 SSSSPTTSSHPSGDLSLSEILA-GKTRKLAARMFFETLVLKSRGLIDMQQDRPYGDIAL 681 >At1g64140.1 68414.m07266 expressed protein similar to putative disease resistance protein GB:CAB40943 GI:4586107 from [Arabidopsis thaliana]; weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 646 Score = 28.3 bits (60), Expect = 3.2 Identities = 19/62 (30%), Positives = 24/62 (38%), Gaps = 6/62 (9%) Frame = -3 Query: 228 SHRHGRRCSALSCTD--RQD*FHCQEH----RVTHSGSRRHELSQPPGIVSRPGSPPCRS 67 SH GRRC + CT + C+ H R THSG + P G C Sbjct: 377 SHGGGRRCQSNGCTKGAQGSTMFCKAHGGGKRCTHSGCTKGAEGSTPFCKGHGGGKRCAF 436 Query: 66 RG 61 +G Sbjct: 437 QG 438 >At1g15190.1 68414.m01816 hypothetical protein Length = 248 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = -2 Query: 193 MHGSSRLISLSGASRDSFRISETRALSASWNRLSSRLSAMPFSRCSDSEMSPRGSPA 23 +HG + L+ L+ S + + ++ AL+ S L SR S P + ++SP SP+ Sbjct: 159 VHGLADLLPLTAPSSPNRLVEDSTALAKSPWFLGSRFSPAPEPYFAFMDLSPAESPS 215 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 27.9 bits (59), Expect = 4.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 111 PPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAAP 7 PP ++RPG PP S+ R APP++ P Sbjct: 90 PPAAMARPGGPPQVSQPGGFPPVGRPVAPPSNQPP 124 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 27.5 bits (58), Expect = 5.6 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -3 Query: 138 GSRRHELSQPPGIVSRPG----SPPCRSRGAPTRRCPRGEAPPTSAAP 7 G + ++S+PP I+ PG PP +G P P G PP P Sbjct: 142 GMMQPQISRPPQIIRPPGQMPPQPPFAGQGGPPP--PYGMRPPYPGPP 187 >At5g09670.2 68418.m01119 loricrin-related contains weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 546 Score = 27.5 bits (58), Expect = 5.6 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -3 Query: 228 SHRHGRRCSALSCTDRQD*FHCQEHRVTHSGSRRHELSQPPGIVSRPGSPPCRSRGAPTR 49 +H G+RC L CT + + ++H G RR E + +R S C G + Sbjct: 199 THGGGKRCEHLGCTKSAE--GKTDFCISHGGGRRCEFLEGCDKAARGRSGLCIKHGG-GK 255 Query: 48 RC 43 RC Sbjct: 256 RC 257 >At5g09670.1 68418.m01118 loricrin-related contains weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 546 Score = 27.5 bits (58), Expect = 5.6 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -3 Query: 228 SHRHGRRCSALSCTDRQD*FHCQEHRVTHSGSRRHELSQPPGIVSRPGSPPCRSRGAPTR 49 +H G+RC L CT + + ++H G RR E + +R S C G + Sbjct: 199 THGGGKRCEHLGCTKSAE--GKTDFCISHGGGRRCEFLEGCDKAARGRSGLCIKHGG-GK 255 Query: 48 RC 43 RC Sbjct: 256 RC 257 >At3g15820.1 68416.m02002 phosphatidic acid phosphatase-related / PAP2-related contains Pfam profile PF01569: PAP2 superfamily Length = 301 Score = 27.5 bits (58), Expect = 5.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 54 SEHLENGMAESLDERRFQEAERARVSEILN 143 S H+ M SLD RR Q A V +ILN Sbjct: 214 SGHVAGSMIASLDMRRMQRLRLAMVFDILN 243 >At3g07440.1 68416.m00887 expressed protein Length = 235 Score = 27.5 bits (58), Expect = 5.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 86 ALRHAVLEVLRLGDVPAGKPRRRRPLRS 3 ++RH + +RL AG+PRRR L S Sbjct: 14 SIRHGGVSQIRLARTEAGQPRRRNKLPS 41 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 27.5 bits (58), Expect = 5.6 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -3 Query: 153 RVTHSGSRRHELSQPPGIVSRPGSPPCRSRGAPTRRCPRGEAPP 22 R + S RR PP +RP PP R+R P R PP Sbjct: 530 RASGSRGRRPRPPLPPPARARPLPPPARARPMPPPARARPLPPP 573 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 27.5 bits (58), Expect = 5.6 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -3 Query: 111 PPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAAP 7 PP P + P S PT P E+PP+ AP Sbjct: 126 PPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAP 160 >At5g64550.1 68418.m08112 loricrin-related contains weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 634 Score = 27.1 bits (57), Expect = 7.4 Identities = 11/37 (29%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 174 NLDDPCMKVHC---SAGRVCEINEHGEAICNCIKECP 275 N D + + C SAGR+ + H +C+ + CP Sbjct: 21 NFGDTALSLKCLGSSAGRLIGSSHHNHKLCSDVSNCP 57 >At5g60930.1 68418.m07643 chromosome-associated kinesin, putative microtubule-associated motor KIF4 , Mus musculus, PIR:A54803 Length = 1294 Score = 27.1 bits (57), Expect = 7.4 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = +3 Query: 27 GLPRGDISESEHLENG----MAESLDERRFQEAERARVSEIL-NESRDAPDNEINLD 182 G ISESE LENG ++ D+ + Q+ +R + +L N D P+ E N D Sbjct: 1100 GKENNSISESEALENGENSQESDEKDKGQQQQVLASRGAMLLQNALADKPEEETNDD 1156 >At5g22010.1 68418.m02561 AAA-type ATPase family protein / BRCT domain-containing protein contains Pfam profiles: PF00533 BRCA1 C Terminus (BRCT) domain, PF00004 ATPase family associated with various cellular activities (AAA) Length = 956 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -3 Query: 426 RSTRSARGGTAPRGTAPSGRGRGSAVG 346 +S RGG A G + GRGRG G Sbjct: 154 KSAGRGRGGRAAPGASTGGRGRGGGRG 180 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 27.1 bits (57), Expect = 7.4 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 117 SQPPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAAP 7 S PP + S P PP S P P ++PP +P Sbjct: 604 SPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSP 640 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.1 bits (57), Expect = 7.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 447 PAFPCKSRSTRSARGGTAPRGTAPSGRG 364 P F CK S R+ R + P G S RG Sbjct: 186 PVFSCKFSSDRNGRSRSLPSGFTYSSRG 213 >At2g44790.1 68415.m05574 uclacyanin II strong similarity to uclacyanin II GI:3399769 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin II GI:3399768 Length = 202 Score = 27.1 bits (57), Expect = 7.4 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -3 Query: 117 SQPPGIVSRPGSPPCRSRGAPTRRCPRGEAPPTSAAP 7 S PG + P SPP S G+PT P A TS P Sbjct: 139 SSTPGTPTTPESPP--SGGSPTPTTPTPGAGSTSPPP 173 >At5g18370.1 68418.m02161 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1210 Score = 26.6 bits (56), Expect = 9.8 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 4/72 (5%) Frame = -2 Query: 241 PCSLISQTRP-ALQCTFMHGSSRLISLSGASRD--SFRISETRALSA-SWNRLSSRLSAM 74 PC+L + +L ++GSSRL + S + +S T S RL SRL + Sbjct: 774 PCALPGDSNMRSLSKLLLNGSSRLKTFPEISTNIQELNLSGTAIEEVPSSIRLWSRLDKL 833 Query: 73 PFSRCSDSEMSP 38 SRC + +M P Sbjct: 834 DMSRCKNLKMFP 845 >At3g58860.1 68416.m06560 F-box family protein contains F-box domain Pfam:PF00646 Length = 457 Score = 26.6 bits (56), Expect = 9.8 Identities = 19/67 (28%), Positives = 32/67 (47%) Frame = -2 Query: 331 DDQVSLKFVHTLRLESVSYGHSLMQLQIASPCSLISQTRPALQCTFMHGSSRLISLSGAS 152 DD + L + TL LESV +G Q + + C ++ + L M R + LS +S Sbjct: 157 DDDMFLPMLKTLVLESVEFGRGQFQTLLPA-CPVLEE----LMLLNMEWKDRNVILSSSS 211 Query: 151 RDSFRIS 131 + +I+ Sbjct: 212 LKNLKIT 218 >At3g10650.1 68416.m01281 expressed protein Length = 1309 Score = 26.6 bits (56), Expect = 9.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 229 STSTGKLSATASRSVHTKPTLGARCAQTSTRPG 327 +TST K AS T GA+ A+ +RPG Sbjct: 863 NTSTFKFGGMASADQSTGIVFGAKSAENKSRPG 895 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,672,305 Number of Sequences: 28952 Number of extensions: 258725 Number of successful extensions: 1181 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 1070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1179 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -