BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_G16 (499 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 2.0 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 3.5 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 3.5 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 4.7 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.1 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.6 bits (46), Expect = 2.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 134 FVRITWKRLVSIYLSHNEFIKKTFNYFTVVIHI 232 F R L+ +YL HN+ + T + F + H+ Sbjct: 242 FFRPVELSLMQLYLGHNKLLNATKDLFGNMPHL 274 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 3.5 Identities = 7/28 (25%), Positives = 17/28 (60%) Frame = -2 Query: 330 ITIQKVTVSFCHHFFLATVFFNYQCLIE 247 +++ ++ FC+ +L TV++ Y + E Sbjct: 138 VSLLQLVFVFCYFIYLFTVYYIYYSVHE 165 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 3.5 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 312 TVSFCHHFFLATVFFNYQCLIEDKR*HM 229 +VS CH F ++ + NY R H+ Sbjct: 134 SVSSCHQGFSSSTWCNYSAYSSASRHHV 161 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 4.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 38 MTCEFSINVLRE 3 MTC F INVL E Sbjct: 501 MTCLFCINVLAE 512 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 20.6 bits (41), Expect = 8.1 Identities = 5/23 (21%), Positives = 16/23 (69%) Frame = +2 Query: 149 WKRLVSIYLSHNEFIKKTFNYFT 217 W++ ++++L+HN + +++T Sbjct: 656 WRQTLAMWLNHNPNYAEVTDWYT 678 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,516 Number of Sequences: 336 Number of extensions: 2091 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -