BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_G09 (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1677| Best HMM Match : WD40 (HMM E-Value=0.00074) 113 2e-25 SB_14107| Best HMM Match : Herpes_UL3 (HMM E-Value=4.8) 29 4.5 SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 >SB_1677| Best HMM Match : WD40 (HMM E-Value=0.00074) Length = 1087 Score = 113 bits (271), Expect = 2e-25 Identities = 46/89 (51%), Positives = 63/89 (70%) Frame = +1 Query: 223 IMTSGRIIIYGGRGALGSACVNHFKSSNWWVANIDLNPNESADFNVAVPKDASWVQQEQH 402 +++ R++IYGG+GALG+ CV++FK+ WWVA++DL PNE A NV V SW +Q Sbjct: 90 VVSGSRVLIYGGKGALGATCVSYFKAREWWVASVDLFPNEEAHANVIVDPAKSWDEQNNE 149 Query: 403 VVNELSNALQGQKVNAVICVAGGWAGGNA 489 V ++ L G K+NA+ICVAGGWAGG A Sbjct: 150 VQKKVDELLDGNKLNAIICVAGGWAGGTA 178 >SB_14107| Best HMM Match : Herpes_UL3 (HMM E-Value=4.8) Length = 314 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -2 Query: 610 HQSRQVIHPAPSILQLMWLRLSNSRPIAATSSLP 509 H SRQ+ P++L ++ SN +P+ A LP Sbjct: 138 HFSRQMPQFPPNVLNYVYASTSNRKPVTANRGLP 171 >SB_2806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 600 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 145 VKGYFSGTQTLPLLSVSSCPRE*IDVIMTSGRIIIYGGRGALGSACVN 288 V+ Y T+ ++ S PR + V + G++ GGR GS+C+N Sbjct: 393 VERYDPDTKQWSFVAAMSTPRSTVGVAVMDGKLYAVGGRD--GSSCLN 438 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,272,214 Number of Sequences: 59808 Number of extensions: 415880 Number of successful extensions: 910 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 910 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -