BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_G09 (668 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 3.5 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 22 4.6 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 6.1 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 6.1 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.0 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +3 Query: 381 VGTTGATCSQRTK*RFARSESECCY 455 +G TC+ +TK FA+ + C Y Sbjct: 433 IGCECKTCNSKTKCCFAQDDGLCPY 457 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/49 (22%), Positives = 23/49 (46%) Frame = -2 Query: 607 QSRQVIHPAPSILQLMWLRLSNSRPIAATSSLPAYSGPWQRFRLPNHQR 461 +S Q++H ++ L +L + + S L Y W+ +P +Q+ Sbjct: 194 ESFQILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYIPLYQQ 242 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 405 YMLLLLYPRGIFR 367 Y LL YPR IFR Sbjct: 382 YSSLLRYPRSIFR 394 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.8 bits (44), Expect = 6.1 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 244 IIYGGRGALGSACVNHFKSSNWWVANIDLNPNESA 348 I+ GG A + SNW V ++ P+E A Sbjct: 72 IVVGGGAARAVVAGRLSEVSNWKVLLLEAGPDEPA 106 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -1 Query: 614 LAPVKASNPPGAKYFAANVAAIVELQ 537 + PV PP F+ A+VE Q Sbjct: 1 MGPVFVKEPPNRVDFSNGTGAVVECQ 26 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,511 Number of Sequences: 438 Number of extensions: 3799 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -