BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_G07 (438 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 134 1e-33 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 26 0.67 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 25 1.2 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 3.6 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 23 4.8 AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription fact... 22 8.3 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 134 bits (324), Expect = 1e-33 Identities = 59/85 (69%), Positives = 71/85 (83%) Frame = +1 Query: 178 LFEKRTKNFAIGQDIQPTRDLSRFVRWPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKT 357 LFEKR KN+ IGQ++QP RDLSRFV+WPKYIRIQR +A+LQ+RLK+PPPINQFTQTLDK Sbjct: 37 LFEKRVKNYGIGQNVQPKRDLSRFVKWPKYIRIQRHRAILQKRLKIPPPINQFTQTLDKP 96 Query: 358 TAKGLFKILEKYRPETEAVRKERLK 432 TA+ + K +KYRPE R +RLK Sbjct: 97 TAQQVMKCWKKYRPENPIARVQRLK 121 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.8 bits (54), Expect = 0.67 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 267 YSHPASKGCVTASSQSAAANQPVHP 341 + HP G + A SQ QPVHP Sbjct: 165 HHHPGLTGLMQAPSQQQQHLQPVHP 189 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 25.0 bits (52), Expect = 1.2 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = +1 Query: 256 WPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPE 402 W ++ + + RLKV + T+T+++ A+ + L ++RPE Sbjct: 216 WKLFLMTSYRSVARKLRLKVCS--RELTETVERVAAEAINSKLHEHRPE 262 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 3.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 108 DREKSSGRSTCGEES*AQEDCKPS 179 DR ++ GRS C S + D +PS Sbjct: 884 DRSEAGGRSLCTNGSSSGRDSQPS 907 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.0 bits (47), Expect = 4.8 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +2 Query: 248 SCDGRNIFASSVK--RLCYSVVSKCRRQSTSSPRH*IKPQPKVCSRSWRNTGQKLRQS 415 S D ++ + ++ R + + + RR SP H KP+ + R W+ GQ L +S Sbjct: 204 SVDSSSVLGNGIQLHRHQHQLQPQQRRFHRQSPAHRRKPRWRRAGRRWK-VGQFLPES 260 >AJ439353-9|CAD27931.1| 391|Anopheles gambiae transcription factor protein. Length = 391 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 235 DLSRFVRWPKYIRIQRQKAVLQRRLKVPPP 324 D++R++ W K I+ R A+ ++L+ P P Sbjct: 343 DVARWLEWRKKIKEYRMTAM--KKLQPPKP 370 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 424,138 Number of Sequences: 2352 Number of extensions: 7570 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -