BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_F24 (217 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 25 0.077 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 24 0.18 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 24 0.18 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 24 0.18 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 24 0.18 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 0.18 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 24 0.18 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 1.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 2.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 2.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 2.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 2.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 2.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 2.2 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 2.2 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 20 2.9 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 20 2.9 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 20 2.9 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 20 2.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 20 2.9 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 20 2.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 20 2.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 20 2.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 20 2.9 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 20 2.9 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 20 2.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 3.8 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 19 5.1 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 19 6.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 19 6.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 19 6.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 19 6.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 19 6.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 19 6.7 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 19 6.7 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 19 6.7 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 19 6.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 19 8.8 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 19 8.8 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 19 8.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 19 8.8 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 19 8.8 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 19 8.8 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.4 bits (53), Expect = 0.077 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = -1 Query: 181 RRNQHTRHRRLSAVYLCVHSYNYS*HKRCQRTSVSLRSYWRRSVRTSRWYSREDTLSY 8 + N+ T HR + AV + K+ +S SLRS R RTS +SR + L + Sbjct: 182 KTNEITEHRTVLAVNIEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDLRH 239 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.18 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 181 RRNQHTRHRRLSAVYLCVHSYNYS*HKRCQRTSVSLRSYWRRSVRTSRWYSR-EDT 17 + N+ T HR + AV + K+ +S SLRS R RTS +SR ED+ Sbjct: 182 KTNEITEHRTVLAVNIEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDS 237 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.18 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 181 RRNQHTRHRRLSAVYLCVHSYNYS*HKRCQRTSVSLRSYWRRSVRTSRWYSR-EDT 17 + N+ T HR + AV + K+ +S SLRS R RTS +SR ED+ Sbjct: 182 KTNEITEHRTVLAVNIEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDS 237 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.18 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 181 RRNQHTRHRRLSAVYLCVHSYNYS*HKRCQRTSVSLRSYWRRSVRTSRWYSR-EDT 17 + N+ T HR + AV + K+ +S SLRS R RTS +SR ED+ Sbjct: 182 KTNEITEHRTVLAVNIEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDS 237 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.18 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 181 RRNQHTRHRRLSAVYLCVHSYNYS*HKRCQRTSVSLRSYWRRSVRTSRWYSR-EDT 17 + N+ T HR + AV + K+ +S SLRS R RTS +SR ED+ Sbjct: 182 KTNEITEHRTVLAVNIEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDS 237 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 24.2 bits (50), Expect = 0.18 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 181 RRNQHTRHRRLSAVYLCVHSYNYS*HKRCQRTSVSLRSYWRRSVRTSRWYSR-EDT 17 + N+ T HR + AV + K+ +S SLRS R RTS +SR ED+ Sbjct: 182 KTNEITEHRTVLAVNIEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDS 237 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.2 bits (50), Expect = 0.18 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 181 RRNQHTRHRRLSAVYLCVHSYNYS*HKRCQRTSVSLRSYWRRSVRTSRWYSR-EDT 17 + N+ T HR + AV + K+ +S SLRS R RTS +SR ED+ Sbjct: 182 KTNEITEHRTVLAVNIEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDS 237 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 1.7 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 115 NYNCEHKDT 141 NYN EHK+T Sbjct: 187 NYNWEHKET 195 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 2.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 2.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 2.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 2.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 2.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 197 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 227 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 20.6 bits (41), Expect = 2.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSHYSRERSCS 238 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 20.6 bits (41), Expect = 2.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 85 KSFGSVCVMNNYN 123 K+F C +NNYN Sbjct: 150 KNFHPRCAVNNYN 162 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 197 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 227 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 197 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 227 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHGFQHTSSRYSRERSCS 238 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 20.2 bits (40), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLRS TS YSRE + S Sbjct: 208 KKYATSSNSLRSRTHDFQHTSSRYSRERSCS 238 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 20.2 bits (40), Expect = 2.9 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 161 PSPTFRSVSLCSQL*LFMT 105 PS + VSLCS + L +T Sbjct: 274 PSDSGEKVSLCSSILLSLT 292 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 19.8 bits (39), Expect = 3.8 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 52 PICASKNGE 78 P C+SKNGE Sbjct: 893 PGCSSKNGE 901 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 19.4 bits (38), Expect = 5.1 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +1 Query: 43 KFEPICASKNG 75 K E +CA +NG Sbjct: 28 KIESVCAEENG 38 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 19.0 bits (37), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLR+ TS YSRE + S Sbjct: 197 KKYATSSNSLRNRTHGFQHTSSRYSRERSCS 227 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 19.0 bits (37), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLR+ TS YSRE + S Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRERSCS 238 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 19.0 bits (37), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLR+ TS YSRE + S Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRERSCS 238 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 19.0 bits (37), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLR+ TS YSRE + S Sbjct: 197 KKYATSSNSLRNRTHGFQHTSSRYSRERSCS 227 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 19.0 bits (37), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLR+ TS YSRE + S Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRERSCS 238 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 19.0 bits (37), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLR+ TS YSRE + S Sbjct: 197 KKYATSSNSLRNRTHGFQHTSSRYSRERSCS 227 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 19.0 bits (37), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLR+ TS YSRE + S Sbjct: 213 KKYATSSNSLRNRTHGFQHTSSRYSRERSCS 243 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 19.0 bits (37), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLR+ TS YSRE + S Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRERSCS 238 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 19.0 bits (37), Expect = 6.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 103 KRCQRTSVSLRSYWRRSVRTSRWYSREDTLS 11 K+ +S SLR+ TS YSRE + S Sbjct: 208 KKYATSSNSLRNRTHGFQHTSSRYSRERSCS 238 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 18.6 bits (36), Expect = 8.8 Identities = 5/17 (29%), Positives = 12/17 (70%) Frame = +2 Query: 146 GKSAMASVLVPTEFASL 196 GK+ ++L+P +++L Sbjct: 185 GKNNQQNILIPVNYSAL 201 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 18.6 bits (36), Expect = 8.8 Identities = 5/10 (50%), Positives = 9/10 (90%) Frame = +2 Query: 125 VNTKIHCGKS 154 V+T++ CG+S Sbjct: 104 VSTRVRCGRS 113 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 18.6 bits (36), Expect = 8.8 Identities = 3/5 (60%), Positives = 5/5 (100%) Frame = +3 Query: 159 WRVCW 173 W++CW Sbjct: 491 WKICW 495 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 18.6 bits (36), Expect = 8.8 Identities = 3/5 (60%), Positives = 5/5 (100%) Frame = +3 Query: 159 WRVCW 173 W++CW Sbjct: 544 WKICW 548 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 18.6 bits (36), Expect = 8.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 206 SLN*ERRIPSEPAH 165 SLN + +P EP H Sbjct: 980 SLNLDSDLPVEPTH 993 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 18.6 bits (36), Expect = 8.8 Identities = 5/10 (50%), Positives = 9/10 (90%) Frame = +2 Query: 125 VNTKIHCGKS 154 V+T++ CG+S Sbjct: 120 VSTRVRCGRS 129 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,966 Number of Sequences: 438 Number of extensions: 1181 Number of successful extensions: 43 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 146,343 effective HSP length: 46 effective length of database: 126,195 effective search space used: 3154875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.4 bits)
- SilkBase 1999-2023 -