BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_F17 (510 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 38 4e-05 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 34 8e-04 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 38.3 bits (85), Expect = 4e-05 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = +2 Query: 29 RIFIGPKYDCMGRLMSINDKRLDMLEIDSFVYKLDTGKNNIVRSS 163 RIF+ PK D G D+++ +E+D F L G+N I R+S Sbjct: 501 RIFLAPKTDERGNPWLFRDQKIMFIELDKFTVNLKQGQNTITRAS 545 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 33.9 bits (74), Expect = 8e-04 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 29 RIFIGPKYDCMGRLMSINDKRLDMLEIDSFVYKLDTGKNNIVRSSLE 169 RIF+ P++D G +++ +E+D F L G N I R S E Sbjct: 500 RIFLAPQFDERGNPWLFRNQKDMFIELDRFAVSLKQGTNTITRHSTE 546 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,953 Number of Sequences: 336 Number of extensions: 2425 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12154132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -