BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_F10 (516 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 29 0.093 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 25 2.0 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 24 3.5 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 23 6.1 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 6.1 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 29.1 bits (62), Expect = 0.093 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 380 TGTGRIDIRFDDDGCQENMKLCCRIPKPLT 469 +G IDIR D C +++ CC PK T Sbjct: 32 SGANIIDIRHPLDDCNDHLMQCCAEPKQAT 61 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 224 NGQTKNIQRVTTVDPMVTTTAAT 292 NG+ K QR P+ TTT +T Sbjct: 492 NGRGKYFQRFAKTTPLTTTTTST 514 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 23.8 bits (49), Expect = 3.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 443 CCRIPKPLTESQALKPNVTNSK 508 CC+IPKP+ + K N K Sbjct: 37 CCKIPKPIDNAIMEKCRAENPK 58 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 272 VTTTAATNGDRRHCQCVPYD 331 V T ATN HCQCV D Sbjct: 182 VCTPNATNTVWSHCQCVLAD 201 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 23.0 bits (47), Expect = 6.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 272 VTTTAATNGDRRHCQCVPYD 331 V T ATN HCQCV D Sbjct: 182 VCTPNATNTVWSHCQCVLAD 201 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 498,898 Number of Sequences: 2352 Number of extensions: 9862 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -