BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_F09 (506 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 25 1.1 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 1.1 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 25 1.5 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 24 2.6 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 2.6 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 3.4 EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. 23 4.5 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 23 4.5 EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. 23 7.9 EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. 23 7.9 EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. 23 7.9 EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. 23 7.9 EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. 23 7.9 EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. 23 7.9 EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. 23 7.9 EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. 23 7.9 EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. 23 7.9 EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. 23 7.9 EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. 23 7.9 EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. 23 7.9 EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. 23 7.9 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 25.4 bits (53), Expect = 1.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 325 FFYFHTYSSVKGTCSLW 375 F Y+H + + G CSLW Sbjct: 234 FAYYHIIAMLNGFCSLW 250 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.4 bits (53), Expect = 1.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 420 HPHLINLFRKSSIIHRPRVHEPTNHSIPY 506 HPHL ++ + H P VH P +H + Y Sbjct: 125 HPHLPHVQQ-----HHPSVHHPAHHPLHY 148 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 25.0 bits (52), Expect = 1.5 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 420 D*ANR*GST*ANVSRPERTCTLNRRVCM 337 D ANR G+ S ++TC LN C+ Sbjct: 75 DTANRFGADDGGASLTQKTCALNGEYCL 102 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 24.2 bits (50), Expect = 2.6 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -3 Query: 444 ETNL*GEGD*ANR*GST*ANVSRPE-RTCTLNRRVCMKVEETKDI 313 ETN+ G G A+ GS+ V RP R+ +LNR +KV ++ + Sbjct: 16 ETNMSGLGGDAHPQGSS-GRVLRPRARSVSLNRVDALKVSDSTPV 59 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 2.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 386 TYLDQREHVPLTDE 345 TYLD +EH+P D+ Sbjct: 594 TYLDAQEHLPYADD 607 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 3.4 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +2 Query: 74 SKERKEAEVRGEFMRIR 124 SKER +A+ RG+F ++R Sbjct: 384 SKERTKAKNRGDFQKLR 400 >EF519441-2|ABP73492.1| 164|Anopheles gambiae CTL4 protein. Length = 164 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 23 QNLCVCPCXNPRGGKLYTTPNLRL 46 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 23.4 bits (48), Expect = 4.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 369 SLVEIRSPKLTLTGLPNHPHL 431 +LVEI L+L G PN P + Sbjct: 6 TLVEIEKNLLSLFGFPNRPKI 26 >EF519478-2|ABP73566.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519477-2|ABP73564.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519476-2|ABP73562.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519475-2|ABP73560.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519474-2|ABP73558.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519473-2|ABP73556.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519472-2|ABP73554.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519471-2|ABP73552.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519470-2|ABP73550.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519469-2|ABP73548.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519468-2|ABP73546.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519467-2|ABP73544.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519466-2|ABP73542.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519465-2|ABP73540.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519464-2|ABP73538.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519463-2|ABP73536.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519462-2|ABP73534.1| 163|Anopheles gambiae CTL4 protein. Length = 163 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 22 QNLCVCPCGNPRGGKLYTTPNLRL 45 >EF519461-2|ABP73532.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519460-2|ABP73530.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 25 QNLCVCPCGNPRGGKLYTTPNLRL 48 >EF519459-2|ABP73528.1| 166|Anopheles gambiae CTL4 protein. Length = 166 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 25 QNLCVCPCGNPRGGKLYTTPNLRL 48 >EF519458-2|ABP73526.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519457-2|ABP73524.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519456-2|ABP73522.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519455-2|ABP73520.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519454-2|ABP73518.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 20 QNLCVCPCGNPRGGKLYTTPNLRL 43 >EF519453-2|ABP73516.1| 176|Anopheles gambiae CTL4 protein. Length = 176 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 35 QNLCVCPCGNPRGGKLYTTPNLRL 58 >EF519452-2|ABP73514.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519451-2|ABP73512.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 30 QNLCVCPCGNPRGGKLYTTPNLRL 53 >EF519450-2|ABP73510.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 30 QNLCVCPCGNPRGGKLYTTPNLRL 53 >EF519449-2|ABP73508.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519448-2|ABP73506.1| 171|Anopheles gambiae CTL4 protein. Length = 171 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 30 QNLCVCPCGNPRGGKLYTTPNLRL 53 >EF519447-2|ABP73504.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519446-2|ABP73502.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519445-2|ABP73500.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519444-2|ABP73498.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519443-2|ABP73496.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519442-2|ABP73494.1| 177|Anopheles gambiae CTL4 protein. Length = 177 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 36 QNLCVCPCGNPRGGKLYTTPNLRL 59 >EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 24 QNLCVCPCGNPRGGKLYTTPNLRL 47 >EF519439-2|ABP73488.1| 152|Anopheles gambiae CTL4 protein. Length = 152 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 11 QNLCVCPCGNPRGGKLYTTPNLRL 34 >EF519438-2|ABP73486.1| 161|Anopheles gambiae CTL4 protein. Length = 161 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 20 QNLCVCPCGNPRGGKLYTTPNLRL 43 >EF519437-2|ABP73484.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 22.6 bits (46), Expect = 7.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 233 KHLCVCPMMSSRGAEAALVFPLRL 162 ++LCVCP + RG + LRL Sbjct: 24 QNLCVCPCGNPRGGKLYTTPNLRL 47 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 536,999 Number of Sequences: 2352 Number of extensions: 10992 Number of successful extensions: 75 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -