BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_F06 (653 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC800.07c |tsf1||mitochondrial translation elongation factor E... 26 5.5 SPBC1198.10c |||asparagine-tRNA ligase Slm5|Schizosaccharomyces ... 26 5.5 SPBC16G5.09 |||serine carboxypeptidase |Schizosaccharomyces pomb... 26 5.5 SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosac... 26 5.5 SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces ... 25 7.2 SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit ... 25 9.5 >SPBC800.07c |tsf1||mitochondrial translation elongation factor EF-Ts Tsf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 299 Score = 25.8 bits (54), Expect = 5.5 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = -2 Query: 361 IVKKSGFISEKVLLRLMYGLVASL*STSPKNLSISTRLPSPAPDL*RSISIITPNGEDTT 182 IVK + F EKV ++ ++ + A + ST+ S + SP L R S++ N + +T Sbjct: 184 IVKMTSFTGEKVQVQRLHCMNARVPSTAIGIFSHGAKQSSPLQQLGRIGSMVQINSDLST 243 >SPBC1198.10c |||asparagine-tRNA ligase Slm5|Schizosaccharomyces pombe|chr 2|||Manual Length = 441 Score = 25.8 bits (54), Expect = 5.5 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +3 Query: 285 DYSEATNPYISLSKTFSEMNPDFFTMANKIYVGNKYTLDEKFTSSSRQYQSE 440 D +A + S SK F+E NP T ++ G +TL + T ++ ++ + Sbjct: 141 DSLKALRQFFS-SKDFTETNPPIITSSDCEGAGEVFTLTPQETHKNKSFERD 191 >SPBC16G5.09 |||serine carboxypeptidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 510 Score = 25.8 bits (54), Expect = 5.5 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 213 LMLLYKSGAGEGSRVEIDKFLGDVDYSEATNP 308 L+ K G+G G + + FLGD+ Y + P Sbjct: 243 LLAFDKIGSGSGDLSKCESFLGDILYMVSKEP 274 >SPCC736.14 |dis1||microtubule-associated protein Dis1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 882 Score = 25.8 bits (54), Expect = 5.5 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = -2 Query: 301 VASL*STSPKNLSISTRLPSPAPDL*RSISIITPNGEDTTFLSFPDVYASLRS 143 VAS TSP L+++ + PSP P S + +T T SLRS Sbjct: 549 VASPLKTSPVKLAVTPQAPSPLPSSNPSQASLTEESLSTRSSPTKPSTTSLRS 601 >SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 25.4 bits (53), Expect = 7.2 Identities = 16/68 (23%), Positives = 31/68 (45%) Frame = +3 Query: 171 KDKNVVSSPLGVMMLMLLYKSGAGEGSRVEIDKFLGDVDYSEATNPYISLSKTFSEMNPD 350 ++ N + + + L ++ E + +D+ +V E+TN +L T + D Sbjct: 367 EENNSLKQQIEQLQRELASETVVKENLKSSLDQQSANVQKLESTNR--ALESTIKTLEED 424 Query: 351 FFTMANKI 374 +TM NKI Sbjct: 425 VYTMKNKI 432 >SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit Bdp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 507 Score = 25.0 bits (52), Expect = 9.5 Identities = 22/93 (23%), Positives = 43/93 (46%), Gaps = 8/93 (8%) Frame = +3 Query: 252 RVEIDKFLGDVDYS-----EATNPYISLSKTFSEMNP---DFFTMANKIYVGNKYTLDEK 407 ++E+D + +YS N I L +T E++ DF + YV + +L + Sbjct: 295 KMEVDGLNNNSNYSATPRTRVVNGQIVLDETSLEVDRHERDFVPAEEREYV-EENSLSRR 353 Query: 408 FTSSSRQYQSEVETIDFSDTKKAADIINQWANE 506 TS++ + + E + DT+K ++QW + Sbjct: 354 VTSATWGNRQKPEKWNAMDTEKFYKALSQWGTD 386 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,673,861 Number of Sequences: 5004 Number of extensions: 55508 Number of successful extensions: 162 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -