BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E24 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1215.02c |arm1|mdm20|NatB N-acetyltransferase complex non ca... 28 1.3 SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|c... 27 1.8 SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 26 4.1 SPBPJ4664.05 |||conserved fungal protein|Schizosaccharomyces pom... 26 4.1 SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ub... 25 7.2 SPBC29A3.13 |||PWWP domain protein|Schizosaccharomyces pombe|chr... 25 7.2 SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo... 25 7.2 SPAC23H3.08c |bub3||mitotic spindle checkpoint protein Bub3|Schi... 25 9.5 SPAC12B10.13 |||CTLH domain|Schizosaccharomyces pombe|chr 1|||Ma... 25 9.5 SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity fac... 25 9.5 SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 25 9.5 SPAC3F10.05c |mug113||DUF1766 family protein|Schizosaccharomyces... 25 9.5 >SPBC1215.02c |arm1|mdm20|NatB N-acetyltransferase complex non catalytic subunit Arm1|Schizosaccharomyces pombe|chr 2|||Manual Length = 811 Score = 27.9 bits (59), Expect = 1.3 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = -3 Query: 203 RSSNVYPMIDCSFYPMSSLELYRNLLCRTSQSLSIGLR---LVQNSESAKFRHQLDDQRW 33 R++ YP S Y SSL++Y + T + +S+ Q + FR +LD W Sbjct: 480 RATTYYPSSVTSHYINSSLKIYGSNEFETPEMISMAYEDGAYSQIEDMRNFRSRLDHSTW 539 Query: 32 RML 24 + + Sbjct: 540 KSI 542 >SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1717 Score = 27.5 bits (58), Expect = 1.8 Identities = 17/58 (29%), Positives = 24/58 (41%) Frame = -1 Query: 601 ISDLIGHRDCLQFLYVLSSFAHINVYVVIYVKDEAVAFIHGRYQWVYLSHSNIPLAFN 428 + L G D Q VL + V+ D+ V ++ Y W Y H NI +A N Sbjct: 1461 VMTLEGSTDLAQSTVVLPPLP-TEIADVLDAHDQRVLDLYKTYAWYYQKHGNIGVAAN 1517 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 26.2 bits (55), Expect = 4.1 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = -1 Query: 619 STVVVLI-----SDLIGHRDCLQFLYVLSSFAHINVYVVIYVKDEAVA 491 S VV+LI +DLI L+FLY +S A+I Y Y D A + Sbjct: 676 SKVVILIYLGTENDLIALELLLKFLYEETSIAYIYTYDEFYKDDYATS 723 >SPBPJ4664.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 163 Score = 26.2 bits (55), Expect = 4.1 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 236 PLPLHPD*SRFRSSNVYPMIDCSFY-PMSSLELYRNLLCRTSQSLSIGLRLVQNSESAKF 60 PLPL+ D S VY +ID F+ P SL + +LL S ++S L + + + KF Sbjct: 56 PLPLNFDISVHLMPTVYTLIDYLFFSPPFSLSIGPSLLVYLSIAVSYMLWVEKCYQMNKF 115 >SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ubp21|Schizosaccharomyces pombe|chr 2|||Manual Length = 1129 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +2 Query: 107 DFGKFYKGDSYIILKTTSDKRNNLSWDIHYWIGSETSQDEAG 232 D F D +L TT KRN WD+ + ++D +G Sbjct: 606 DMTDFSASDDDPVLITTKIKRNANIWDLQKHLAGLLNRDTSG 647 >SPBC29A3.13 |||PWWP domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 359 Score = 25.4 bits (53), Expect = 7.2 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 4/80 (5%) Frame = -1 Query: 460 LSHSNIPLAFNLEHTF----LGTRIRHDVVETGRVTPIQVL*CRCEVL*EVVTLVAHSLA 293 LS PL+ N +H G + + E GR++P L + + L + + H L Sbjct: 214 LSDQRYPLSSNFDHRGEAKGKGKQPLKNPQERGRISPSSPLNDQTKALMQRLLFFRHKLQ 273 Query: 292 VLYRRSTELVIEADSQDGSR 233 + L++E D + S+ Sbjct: 274 KAFLSPDHLIVEEDFYNASK 293 >SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1045 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -3 Query: 194 NVYPMIDCSFYPMSSLELYR 135 N+YP+ID S Y +S+ Y+ Sbjct: 954 NIYPVIDDSIYELSAASKYQ 973 >SPAC23H3.08c |bub3||mitotic spindle checkpoint protein Bub3|Schizosaccharomyces pombe|chr 1|||Manual Length = 320 Score = 25.0 bits (52), Expect = 9.5 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 2/64 (3%) Frame = +2 Query: 5 TKARVHPAFANAGRQAGVEIWRIQNFEPVAVQSKDFGK--FYKGDSYIILKTTSDKRNNL 178 +K R+ F + +W ++ +PV + +D GK F IL +R NL Sbjct: 102 SKLRLENCFISGSWDKSFRVWDVRVKQPV--EGQDIGKKIFASSSRDNILVLGCSERENL 159 Query: 179 SWDI 190 +DI Sbjct: 160 VYDI 163 >SPAC12B10.13 |||CTLH domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 240 Score = 25.0 bits (52), Expect = 9.5 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -3 Query: 206 FRSSNVYPMIDCSFYPMSSLELYRNLLCRTSQSLSIGLRLVQN 78 F N+ P+ + ++SLEL +LLC S S L+ V N Sbjct: 140 FAHENLAPLAPSNQKFLNSLELTMSLLCFPPSSYSPALKNVLN 182 >SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity factor complex subunit, Fip1 homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 344 Score = 25.0 bits (52), Expect = 9.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 446 HSSCL*PGTYVSRHPDSSRR 387 HS P YV+ +P SSRR Sbjct: 242 HSGAATPNAYVNNNPSSSRR 261 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +3 Query: 252 SASMTSSVERRYNTARLWATRVTTSYSTSHLHYNTWMG 365 + ++S + N L ++ + TSYS S + Y++W G Sbjct: 48 NTDLSSQFFEQTNNGSL-SSLIDTSYSNSQICYSSWQG 84 >SPAC3F10.05c |mug113||DUF1766 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 326 Score = 25.0 bits (52), Expect = 9.5 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = +2 Query: 455 RQVDPLISSMNKGDCFILDINNDI 526 R+V ++ +N GD F+L++ + Sbjct: 110 REVTTIVKDLNNGDSFVLNVTEPV 133 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,832,843 Number of Sequences: 5004 Number of extensions: 61186 Number of successful extensions: 217 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 217 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -