BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E23 (483 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 25 1.8 AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 4.2 AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 4.2 AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 4.2 AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 4.2 AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 4.2 AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 4.2 AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase pr... 23 4.2 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 23 4.2 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 22 9.6 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 1.8 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 Query: 242 TKPAPPRSRSWSCC*PGKPRGNSCISSTTPTRTCLETYAKA 364 T PP + +WS P P + T PT T Y A Sbjct: 230 TTHVPPTTTTWSDLPPPPPTTTTTTVWTDPTTTTTTDYTTA 270 >AY341231-1|AAR13795.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 4.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -1 Query: 396 CKRHVLGNKRQALAYVSRQVRVGVVDEMHEFPRGFPGQQHDQL 268 C++HVL +Y V E RGFPG + L Sbjct: 125 CEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDL 167 >AY341230-1|AAR13794.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 4.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -1 Query: 396 CKRHVLGNKRQALAYVSRQVRVGVVDEMHEFPRGFPGQQHDQL 268 C++HVL +Y V E RGFPG + L Sbjct: 125 CEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDL 167 >AY341229-1|AAR13793.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 4.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -1 Query: 396 CKRHVLGNKRQALAYVSRQVRVGVVDEMHEFPRGFPGQQHDQL 268 C++HVL +Y V E RGFPG + L Sbjct: 125 CEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDL 167 >AY341228-1|AAR13792.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 4.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -1 Query: 396 CKRHVLGNKRQALAYVSRQVRVGVVDEMHEFPRGFPGQQHDQL 268 C++HVL +Y V E RGFPG + L Sbjct: 125 CEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDL 167 >AY341227-1|AAR13791.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 4.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -1 Query: 396 CKRHVLGNKRQALAYVSRQVRVGVVDEMHEFPRGFPGQQHDQL 268 C++HVL +Y V E RGFPG + L Sbjct: 125 CEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDL 167 >AY341226-1|AAR13790.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 4.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -1 Query: 396 CKRHVLGNKRQALAYVSRQVRVGVVDEMHEFPRGFPGQQHDQL 268 C++HVL +Y V E RGFPG + L Sbjct: 125 CEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDL 167 >AY341225-1|AAR13789.1| 231|Anopheles gambiae vacuolar ATPase protein. Length = 231 Score = 23.4 bits (48), Expect = 4.2 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -1 Query: 396 CKRHVLGNKRQALAYVSRQVRVGVVDEMHEFPRGFPGQQHDQL 268 C++HVL +Y V E RGFPG + L Sbjct: 125 CEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDL 167 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 23.4 bits (48), Expect = 4.2 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 Query: 474 KFGVFLPAFDLDHSSFHGYRLEKRVGCK 391 KFG ++ D+D+ HG RV K Sbjct: 237 KFGAYVAGADIDYMIVHGKSKPTRVNQK 264 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 315 SRQLHPHGLA*KRTPRLD 368 S +H HGL +RTP +D Sbjct: 375 STTIHWHGLHQRRTPYMD 392 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.315 0.128 0.354 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 477,113 Number of Sequences: 2352 Number of extensions: 9188 Number of successful extensions: 24 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -