BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E20 (512 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59063| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.42 SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) 30 0.97 SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) 28 5.2 SB_47264| Best HMM Match : Ion_trans (HMM E-Value=1.19951e-42) 28 5.2 SB_15869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_12341| Best HMM Match : Death (HMM E-Value=3.3e-08) 28 5.2 SB_9503| Best HMM Match : Bac_DNA_binding (HMM E-Value=3.3) 27 6.9 SB_23528| Best HMM Match : RVT_1 (HMM E-Value=0.00042) 27 6.9 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_19901| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_10056| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=7.7e-05) 27 9.1 SB_34931| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.46) 27 9.1 SB_21554| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_59063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 31.5 bits (68), Expect = 0.42 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +3 Query: 192 SINSTLVRTTSSAARSRCTALSNRDRGLKTYWKKVS 299 S+NS + + ++ RC +S D L+TYW+KV+ Sbjct: 229 SLNSCVSCISQASRADRCLPVSRSDSILETYWRKVN 264 >SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) Length = 943 Score = 30.3 bits (65), Expect = 0.97 Identities = 33/110 (30%), Positives = 42/110 (38%), Gaps = 1/110 (0%) Frame = -2 Query: 442 GLDGSHDDEHLER-QTAEGSER*QKPVRKAKATLIPPTLDALETCSSCVETFFQYVFSPR 266 GL +H D H TAE +R K LIP DA E T V+S Sbjct: 481 GLVRNHSDSHYASLSTAEVKQR-----LKNIGELIPEHEDAKEKLKRLESTRHIMVWSDN 535 Query: 265 SLFDNAVHLERAADDVVLTSVEFIDEAIDFEHVKAFVIDAHEAAHAIVFG 116 S N H +L V+F+DE ++ H VI E H + G Sbjct: 536 STAMNHGH--------ILLLVQFLDEMKEYGHGDVDVISLVEKPHVYIIG 577 >SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) Length = 649 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 288 KKVSTQLEQVSRASRVGGIRVALAFRTGFCY 380 KK+ST+ + RAS V +++ F TG CY Sbjct: 613 KKMSTRSMGLKRASSVKYVQLLYLFNTGKCY 643 >SB_47264| Best HMM Match : Ion_trans (HMM E-Value=1.19951e-42) Length = 1172 Score = 27.9 bits (59), Expect = 5.2 Identities = 20/79 (25%), Positives = 35/79 (44%) Frame = +3 Query: 153 MTNALTCSKSIASSINSTLVRTTSSAARSRCTALSNRDRGLKTYWKKVSTQLEQVSRASR 332 +TN + +KS+ + I T + T+ RSR +S + Y+K + L +S S Sbjct: 283 LTNQIRRNKSVTNQIRRTNEKVTNQIKRSR-LPISLGVTSKQPYYKGNARSLIYISGTSL 341 Query: 333 VGGIRVALAFRTGFCYLSE 389 V + V C+L + Sbjct: 342 VPPLTVRTETPNTLCFLQQ 360 >SB_15869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1420 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/58 (22%), Positives = 30/58 (51%) Frame = +2 Query: 11 VYVARMRRLNHQPFKVSIDVMSDKAVDAVVRIFIGPKYDCMGRLMSINDKRLDMLEID 184 V++A + + + +P S + + ++ IGP + +GR + +++ LD +E D Sbjct: 1097 VFIALLVKTSSEPLPKSGSSIVSRDTLMLLAREIGPAWKALGRALLLDNAELDQIEAD 1154 >SB_12341| Best HMM Match : Death (HMM E-Value=3.3e-08) Length = 194 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 110 IGPKYDCMGRLMSINDKRLDMLEIDSFVYKLDTGK 214 IG ++ +GR++ + D LDM++ D K + K Sbjct: 117 IGKRWKALGRVLRLKDSELDMIDEDESKLKEKSNK 151 >SB_9503| Best HMM Match : Bac_DNA_binding (HMM E-Value=3.3) Length = 110 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 405 GKPPRVPRGNRSLCGKPRRLLYHQLSMLLKPVPVVSKPFSNMF 277 GKPPR P+ SL + H + + KP+P+ + N F Sbjct: 65 GKPPRKPQKTASLKEVLEKFSNHNVIIAPKPMPIETDVNGNDF 107 >SB_23528| Best HMM Match : RVT_1 (HMM E-Value=0.00042) Length = 445 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/55 (23%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 150 SMTNALTCSKSIASSINSTLVRTTSSAARSRCTALSNRDRGLKTYWK-KVSTQLE 311 S+ + + C +S+ ++ + L + R +C AL +D YW+ KV ++ Sbjct: 27 SLLDLVGCVRSLETASRAVLCHQAVISKRQKCLALFGKDSQQFCYWRNKVQVHIK 81 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 405 GKPPRVPRGNRSLCGKPRRLLYHQLSMLLKPVPVVSKPFSNMF 277 GKPPR P+ SL + H + + KP+P+ + N F Sbjct: 800 GKPPRKPQKTASLKEVLEKFSNHNVIIAPKPMPIETDVNGNDF 842 >SB_19901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/63 (23%), Positives = 27/63 (42%) Frame = +3 Query: 177 KSIASSINSTLVRTTSSAARSRCTALSNRDRGLKTYWKKVSTQLEQVSRASRVGGIRVAL 356 K + + L+ + +R + R+R L +K + + SR R G+RV L Sbjct: 132 KKLLKELPEKLIGVLQPSTAARVAEIFKRERALPGGTRKDEKETAKNSRGVRERGVRVEL 191 Query: 357 AFR 365 F+ Sbjct: 192 RFK 194 >SB_10056| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=7.7e-05) Length = 1960 Score = 27.1 bits (57), Expect = 9.1 Identities = 18/70 (25%), Positives = 31/70 (44%) Frame = +3 Query: 42 TSLSRCLSMLCQIRLLTQSFVYLLVPNTIAWAAS*ASMTNALTCSKSIASSINSTLVRTT 221 +SLS L +L + + PNT S S + + S SSI ST++ + Sbjct: 347 SSLSTTLIPSISTSILPYNTTVIATPNTTRLVTSTISSSTVNVSAISTTSSIESTIMESV 406 Query: 222 SSAARSRCTA 251 +S+ + T+ Sbjct: 407 ASSIQLNITS 416 >SB_34931| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.46) Length = 572 Score = 27.1 bits (57), Expect = 9.1 Identities = 18/70 (25%), Positives = 31/70 (44%) Frame = +3 Query: 42 TSLSRCLSMLCQIRLLTQSFVYLLVPNTIAWAAS*ASMTNALTCSKSIASSINSTLVRTT 221 +SLS L +L + + PNT S S + + S SSI ST++ + Sbjct: 129 SSLSTTLIPSISTSILPYNTTVIATPNTTRMVTSSISSSTVNVSAISTTSSIESTIMASV 188 Query: 222 SSAARSRCTA 251 +S+ + T+ Sbjct: 189 ASSIQLNITS 198 >SB_21554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 331 LDALETCSSCVETFFQYVFSPRSLFDNAVHLERAADDVVL 212 LD ++ C++ VFSP +A+H RA D ++ Sbjct: 4 LDWTDSLEQCIDNSIIKVFSPEICKKSAIHAARAEPDELM 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,612,579 Number of Sequences: 59808 Number of extensions: 304782 Number of successful extensions: 897 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 894 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -