BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E18 (522 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084158-23|AAP31422.1| 187|Caenorhabditis elegans Hypothetical... 30 1.2 AC084158-22|AAM15623.1| 214|Caenorhabditis elegans Hypothetical... 30 1.2 AC084158-21|AAK68581.1| 271|Caenorhabditis elegans Hypothetical... 30 1.2 U97001-5|AAB52260.3| 1592|Caenorhabditis elegans Temporarily ass... 29 1.5 Z81085-3|CAB03115.1| 769|Caenorhabditis elegans Hypothetical pr... 29 2.7 U80446-3|AAL77180.1| 889|Caenorhabditis elegans Nuclear pore co... 28 4.7 U80446-2|AAB37803.1| 1562|Caenorhabditis elegans Nuclear pore co... 28 4.7 U41554-3|AAA83298.2| 745|Caenorhabditis elegans Nematode astaci... 28 4.7 Z81541-1|CAB04411.1| 1291|Caenorhabditis elegans Hypothetical pr... 27 8.1 >AC084158-23|AAP31422.1| 187|Caenorhabditis elegans Hypothetical protein Y69A2AR.7c protein. Length = 187 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +3 Query: 108 MKKKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHS 257 ++K QR+ +D+ + L +C +H+NH+ TP P + T FET S Sbjct: 104 LQKMRQRVADDIGEKVLDIC--EHINHNHYTPKMPTK-TEIPEIFETKFS 150 >AC084158-22|AAM15623.1| 214|Caenorhabditis elegans Hypothetical protein Y69A2AR.7b protein. Length = 214 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +3 Query: 108 MKKKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHS 257 ++K QR+ +D+ + L +C +H+NH+ TP P + T FET S Sbjct: 131 LQKMRQRVADDIGEKVLDIC--EHINHNHYTPKMPTK-TEIPEIFETKFS 177 >AC084158-21|AAK68581.1| 271|Caenorhabditis elegans Hypothetical protein Y69A2AR.7a protein. Length = 271 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +3 Query: 108 MKKKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHS 257 ++K QR+ +D+ + L +C +H+NH+ TP P + T FET S Sbjct: 177 LQKMRQRVADDIGEKVLDIC--EHINHNHYTPKMPTK-TEIPEIFETKFS 223 >U97001-5|AAB52260.3| 1592|Caenorhabditis elegans Temporarily assigned gene nameprotein 59 protein. Length = 1592 Score = 29.5 bits (63), Expect = 1.5 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 484 WLTNLEVVWVTSRNLFFGQEYTVSGIKLAIVKE 386 W+TNL + +NL+F +Y + G L ++ + Sbjct: 142 WITNLHYAFQDEKNLYFVMDYYIGGDMLTLLSK 174 >Z81085-3|CAB03115.1| 769|Caenorhabditis elegans Hypothetical protein F46F3.4 protein. Length = 769 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +3 Query: 114 KKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLTFTKPHFE 245 K+ Q+ ++L K++ H + STS+ P +TF+ P FE Sbjct: 325 KENQQKYSELSKMASTDPHSNHSSPSTSSQKAPTLITFSPPSFE 368 >U80446-3|AAL77180.1| 889|Caenorhabditis elegans Nuclear pore complex protein protein6, isoform b protein. Length = 889 Score = 27.9 bits (59), Expect = 4.7 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +3 Query: 183 NHSTSTPSCPVRLTFTKPHFETLHSISYXT--GLWVTLTHSSIT 308 +HS STP P+R + T H + ++ISY T G V +T S T Sbjct: 189 SHSLSTPGRPIRASVT--HHPSRNTISYCTAEGQLVIVTLGSYT 230 >U80446-2|AAB37803.1| 1562|Caenorhabditis elegans Nuclear pore complex protein protein6, isoform a protein. Length = 1562 Score = 27.9 bits (59), Expect = 4.7 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +3 Query: 183 NHSTSTPSCPVRLTFTKPHFETLHSISYXT--GLWVTLTHSSIT 308 +HS STP P+R + T H + ++ISY T G V +T S T Sbjct: 189 SHSLSTPGRPIRASVT--HHPSRNTISYCTAEGQLVIVTLGSYT 230 >U41554-3|AAA83298.2| 745|Caenorhabditis elegans Nematode astacin protease protein38 protein. Length = 745 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 50 HDEKAINFVGNYWQENADLYEEEV 121 HDE A+N Y+Q + DL E++V Sbjct: 75 HDELAVNNADEYFQGDVDLSEQQV 98 >Z81541-1|CAB04411.1| 1291|Caenorhabditis elegans Hypothetical protein F48F5.1 protein. Length = 1291 Score = 27.1 bits (57), Expect = 8.1 Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +3 Query: 24 NRMARKLISTMKRQLTLSETIG--KRTPICMKKKLQRIINDLMKLSLAMCSVQHLNHSTS 197 +++ + T K SET+ K+ P MKK ++ + +L K S ++ ++HS S Sbjct: 498 DKLLESVQQTAKSVSQFSETLASVKKIPDAMKKNVKNVTLELNKRSESLNQSDAISHSAS 557 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,569,436 Number of Sequences: 27780 Number of extensions: 229050 Number of successful extensions: 735 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -