BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E17 (447 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L39891-1|AAB59488.1| 3638|Homo sapiens polycystic kidney disease... 31 2.4 EF452236-1|ABO40479.1| 1866|Homo sapiens NOD4 protein. 30 3.1 AK090439-1|BAC03420.1| 1056|Homo sapiens FLJ00359 protein protein. 30 3.1 AK074182-1|BAB85008.1| 733|Homo sapiens FLJ00255 protein protein. 30 3.1 AK025362-1|BAB15120.1| 1097|Homo sapiens protein ( Homo sapiens ... 30 3.1 AF389420-1|AAO59377.1| 1866|Homo sapiens NOD27 protein. 30 3.1 BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycop... 29 7.2 BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycop... 29 7.2 BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycop... 29 7.2 BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycop... 29 7.2 BC091500-1|AAH91500.1| 829|Homo sapiens ODF2 protein protein. 29 7.2 AY319414-1|AAP83847.1| 657|Homo sapiens outer dense fiber of sp... 29 7.2 AL445287-4|CAH71067.1| 638|Homo sapiens outer dense fiber of sp... 29 7.2 AL359091-21|CAI13504.1| 205|Homo sapiens outer dense fiber of s... 29 7.2 AL359091-20|CAI13503.1| 180|Homo sapiens outer dense fiber of s... 29 7.2 AL359091-19|CAI13502.1| 156|Homo sapiens outer dense fiber of s... 29 7.2 AL359091-18|CAI13501.1| 141|Homo sapiens outer dense fiber of s... 29 7.2 AL359091-17|CAI13500.1| 638|Homo sapiens outer dense fiber of s... 29 7.2 AF012549-1|AAB66337.1| 638|Homo sapiens outer dense fiber prote... 29 7.2 >L39891-1|AAB59488.1| 3638|Homo sapiens polycystic kidney disease-associated protein protein. Length = 3638 Score = 30.7 bits (66), Expect = 2.4 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = +3 Query: 57 VWCHRKRITSRQKMSTQCLWSARKRVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDN 227 +W K + Q + Q L +A V QD D+ + Y + G DY V+ N N Sbjct: 1425 LWASSKVVAPGQLVHFQILLAAGSAVTFRLQDTDEPRAEHSYLRPG-DYRVQVNASN 1480 >EF452236-1|ABO40479.1| 1866|Homo sapiens NOD4 protein. Length = 1866 Score = 30.3 bits (65), Expect = 3.1 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 4 NYEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 99 +++ CP HCP A + CG EN+S + ++C Sbjct: 668 DFDGCPLEP--HCPEALVGCGQIENLSFKSRKC 698 >AK090439-1|BAC03420.1| 1056|Homo sapiens FLJ00359 protein protein. Length = 1056 Score = 30.3 bits (65), Expect = 3.1 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 4 NYEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 99 +++ CP HCP A + CG EN+S + ++C Sbjct: 395 DFDGCPLEP--HCPEALVGCGQIENLSFKSRKC 425 >AK074182-1|BAB85008.1| 733|Homo sapiens FLJ00255 protein protein. Length = 733 Score = 30.3 bits (65), Expect = 3.1 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 4 NYEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 99 +++ CP HCP A + CG EN+S + ++C Sbjct: 681 DFDGCPLEP--HCPEALVGCGQIENLSFKSRKC 711 >AK025362-1|BAB15120.1| 1097|Homo sapiens protein ( Homo sapiens cDNA: FLJ21709 fis, clone COL10077. ). Length = 1097 Score = 30.3 bits (65), Expect = 3.1 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 4 NYEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 99 +++ CP HCP A + CG EN+S + ++C Sbjct: 353 DFDGCPLEP--HCPEALVGCGQIENLSFKSRKC 383 >AF389420-1|AAO59377.1| 1866|Homo sapiens NOD27 protein. Length = 1866 Score = 30.3 bits (65), Expect = 3.1 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 4 NYEDCPSSSGAHCPRA-IQCGVTENVSLQDKRC 99 +++ CP HCP A + CG EN+S + ++C Sbjct: 668 DFDGCPLEP--HCPEALVGCGQIENLSFKSRKC 698 >BC100827-1|AAI00828.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 29.1 bits (62), Expect = 7.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 126 KRVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 224 +R S FQD + DD+YY G+ Y+ EAN D Sbjct: 43 QRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100826-1|AAI00827.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 29.1 bits (62), Expect = 7.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 126 KRVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 224 +R S FQD + DD+YY G+ Y+ EAN D Sbjct: 43 QRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100825-1|AAI00826.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 29.1 bits (62), Expect = 7.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 126 KRVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 224 +R S FQD + DD+YY G+ Y+ EAN D Sbjct: 43 QRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC100824-1|AAI00825.1| 727|Homo sapiens synaptic vesicle glycoprotein 2C protein. Length = 727 Score = 29.1 bits (62), Expect = 7.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 126 KRVLSLFQDVDQVNVDDEYYKIGKDYDVEANID 224 +R S FQD + DD+YY G+ Y+ EAN D Sbjct: 43 QRSYSRFQDEED---DDDYYPAGETYNGEANDD 72 >BC091500-1|AAH91500.1| 829|Homo sapiens ODF2 protein protein. Length = 829 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 22 SSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAP 123 SSSG PR CG SL K+ R+ CGAP Sbjct: 4 SSSGGS-PRFPSCGKNGVTSLTQKKVLRAPCGAP 36 >AY319414-1|AAP83847.1| 657|Homo sapiens outer dense fiber of sperm tails 2 isoform 3 protein. Length = 657 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 22 SSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAP 123 SSSG PR CG SL K+ R+ CGAP Sbjct: 4 SSSGGS-PRFPSCGKNGVTSLTQKKVLRAPCGAP 36 >AL445287-4|CAH71067.1| 638|Homo sapiens outer dense fiber of sperm tails 2 protein. Length = 638 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 22 SSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAP 123 SSSG PR CG SL K+ R+ CGAP Sbjct: 4 SSSGGS-PRFPSCGKNGVTSLTQKKVLRAPCGAP 36 >AL359091-21|CAI13504.1| 205|Homo sapiens outer dense fiber of sperm tails 2 protein. Length = 205 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 22 SSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAP 123 SSSG PR CG SL K+ R+ CGAP Sbjct: 4 SSSGGS-PRFPSCGKNGVTSLTQKKVLRAPCGAP 36 >AL359091-20|CAI13503.1| 180|Homo sapiens outer dense fiber of sperm tails 2 protein. Length = 180 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 22 SSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAP 123 SSSG PR CG SL K+ R+ CGAP Sbjct: 4 SSSGGS-PRFPSCGKNGVTSLTQKKVLRAPCGAP 36 >AL359091-19|CAI13502.1| 156|Homo sapiens outer dense fiber of sperm tails 2 protein. Length = 156 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 22 SSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAP 123 SSSG PR CG SL K+ R+ CGAP Sbjct: 4 SSSGGS-PRFPSCGKNGVTSLTQKKVLRAPCGAP 36 >AL359091-18|CAI13501.1| 141|Homo sapiens outer dense fiber of sperm tails 2 protein. Length = 141 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 22 SSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAP 123 SSSG PR CG SL K+ R+ CGAP Sbjct: 4 SSSGGS-PRFPSCGKNGVTSLTQKKVLRAPCGAP 36 >AL359091-17|CAI13500.1| 638|Homo sapiens outer dense fiber of sperm tails 2 protein. Length = 638 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 22 SSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAP 123 SSSG PR CG SL K+ R+ CGAP Sbjct: 4 SSSGGS-PRFPSCGKNGVTSLTQKKVLRAPCGAP 36 >AF012549-1|AAB66337.1| 638|Homo sapiens outer dense fiber protein 2 protein. Length = 638 Score = 29.1 bits (62), Expect = 7.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +1 Query: 22 SSSGAHCPRAIQCGVTENVSLQDKRCRRSVCGAP 123 SSSG PR CG SL K+ R+ CGAP Sbjct: 4 SSSGGS-PRFPSCGKNGVTSLTQKKVLRAPCGAP 36 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,510,786 Number of Sequences: 237096 Number of extensions: 1167695 Number of successful extensions: 2527 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 2522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2527 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3644351872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -