BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E17 (447 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 29 1.4 At5g40200.1 68418.m04878 DegP protease, putative contains simila... 29 1.9 At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase fa... 28 3.3 At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CH... 27 4.4 At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CH... 27 4.4 At4g34200.1 68417.m04854 D-3-phosphoglycerate dehydrogenase, put... 27 7.6 At4g32610.1 68417.m04643 mitochondrial glycoprotein family prote... 27 7.6 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 29.1 bits (62), Expect = 1.4 Identities = 21/94 (22%), Positives = 39/94 (41%) Frame = +3 Query: 153 VDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRIGYLPKYYEFSIFYQKLREE 332 +DQ+ D+ K+G Y EA IDN ++ + EF +F Q Sbjct: 96 LDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHATALEFRLFRQHGFNV 155 Query: 333 AIALFHLFYYAKDFETFYKSAAFARVALNEGQFL 434 + +F +F ++ F + + ++L E +L Sbjct: 156 SEDVFDVF--MENCGKFDRDDIYGLISLYEASYL 187 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 165 NVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRI 275 N +DEY K DYD +D T K+A + L + I Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCI 578 >At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|Q9Y2Q0, SP|O43520]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1228 Score = 27.9 bits (59), Expect = 3.3 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -2 Query: 404 SESGTLVEG-FKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQ 258 S SG ++E +KV +++E K + + E+G++++L K DS+ F+ Sbjct: 595 SGSGQIIEREYKVLNLLEFTSKRKRMTVIVRDEEGQILLLCKGADSIIFE 644 >At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 742 Score = 27.5 bits (58), Expect = 4.4 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -2 Query: 299 LIVLGKITDSVQFQEFFNSFLIGVVI 222 ++V G ITD++ F +F++GV+I Sbjct: 204 VLVCGFITDAIGIHSMFGAFVVGVLI 229 >At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 810 Score = 27.5 bits (58), Expect = 4.4 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -2 Query: 299 LIVLGKITDSVQFQEFFNSFLIGVVI 222 ++V G ITD++ F +F++GV+I Sbjct: 272 VLVCGFITDAIGIHSMFGAFVVGVLI 297 >At4g34200.1 68417.m04854 D-3-phosphoglycerate dehydrogenase, putative / 3-PGDH, putative similar to phosphoglycerate dehydrogenase, Arabidopsis thaliana, SP:O04130 Length = 603 Score = 26.6 bits (56), Expect = 7.6 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = -2 Query: 365 SIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQEFFNSFLIGVVID 219 +I Q+ S F L E GE+ V GK+ D V SF + V ++ Sbjct: 480 TITVQLSNVESKFASSLSESGEVKVEGKVKDGVPHLTKVGSFEVDVTLE 528 >At4g32610.1 68417.m04643 mitochondrial glycoprotein family protein / MAM33 family protein low similarity to SP|P40513 Mitochondrial acidic protein MAM33, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF02330: Mitochondrial glycoprotein Length = 557 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +3 Query: 72 KRITSRQKMSTQCLWSARKRVLSLFQDVDQVNVDDEYY 185 KR S+++ Q W+ + D+D + DD+YY Sbjct: 44 KREDSQKEPEPQVFWAPTPLKAKAWADIDSDDEDDDYY 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,078,471 Number of Sequences: 28952 Number of extensions: 169935 Number of successful extensions: 476 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 722638680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -