BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E16 (567 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40415-5|AAK39251.1| 655|Caenorhabditis elegans Hypothetical pr... 34 0.082 U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical p... 32 0.25 AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synapt... 32 0.25 AL110478-11|CAB54347.2| 1435|Caenorhabditis elegans Hypothetical... 29 1.8 Z78543-1|CAB01753.2| 1170|Caenorhabditis elegans Hypothetical pr... 29 3.1 Z81479-1|CAB03944.1| 1043|Caenorhabditis elegans Hypothetical pr... 28 5.4 Z81112-6|CAB03277.1| 673|Caenorhabditis elegans Hypothetical pr... 28 5.4 Z77136-10|CAB00887.1| 673|Caenorhabditis elegans Hypothetical p... 28 5.4 >U40415-5|AAK39251.1| 655|Caenorhabditis elegans Hypothetical protein K02G10.5 protein. Length = 655 Score = 33.9 bits (74), Expect = 0.082 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +1 Query: 397 IEKCAENCISTPEYNPVCGSDXK-TYKNQGRLFCAQNCGVXVTLARQAPCPSS 552 +E C+ENC +NPVC D K T+ + CA G+ + C S Sbjct: 442 LETCSENCHCDSFFNPVCSEDSKLTFLSPCHAGCADMPGIKFGASNWTNCGCS 494 >U39999-14|ABF71722.1| 1483|Caenorhabditis elegans Hypothetical protein F41G3.12 protein. Length = 1483 Score = 32.3 bits (70), Expect = 0.25 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 427 TPEYNPVCGSDXKTYKNQGRL 489 T E+ VCGSD KTY N+ RL Sbjct: 469 TDEFKEVCGSDGKTYSNECRL 489 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 403 KCAENCISTPEYNPVCGSDXKTYKNQ 480 KC+E C + VCG+D KTY N+ Sbjct: 318 KCSEQCTMNSAH--VCGTDGKTYLNE 341 >AM773423-1|CAO78927.1| 1473|Caenorhabditis elegans AGRin (synaptic protein) homologfamily member protein. Length = 1473 Score = 32.3 bits (70), Expect = 0.25 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 Query: 427 TPEYNPVCGSDXKTYKNQGRL 489 T E+ VCGSD KTY N+ RL Sbjct: 477 TDEFKEVCGSDGKTYSNECRL 497 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 403 KCAENCISTPEYNPVCGSDXKTYKNQ 480 KC+E C + VCG+D KTY N+ Sbjct: 326 KCSEQCTMNSAH--VCGTDGKTYLNE 349 >AL110478-11|CAB54347.2| 1435|Caenorhabditis elegans Hypothetical protein Y26D4A.9 protein. Length = 1435 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = -3 Query: 556 LMKTGTGLAWPKSLXLHNFGHKIVFPGFCKFYXRYHTRGCILVLKCNS 413 L KTG L K + ++NF K + G C RY + KCN+ Sbjct: 950 LKKTGVKLQTIKDIEMYNFIEKGIRGGICNAMLRYSRANNRHLKKCNT 997 >Z78543-1|CAB01753.2| 1170|Caenorhabditis elegans Hypothetical protein F29G6.1 protein. Length = 1170 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 388 RQTIEKCAENCISTPEYNPVCGSDXKTYKN 477 R + + C NC +T E++PVC ++ Y+N Sbjct: 109 RCSSKDCNHNCTNT-EFDPVCDTNGSVYRN 137 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 400 EKCAENCISTPEYNPVCGSDXKTYKNQGRLFCAQNC 507 E C C T + +P+C SD TY+N + F Q C Sbjct: 584 EACQMPC--TDDKHPICASDFSTYENLCQ-FRKQKC 616 >Z81479-1|CAB03944.1| 1043|Caenorhabditis elegans Hypothetical protein C34F6.1 protein. Length = 1043 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 391 QTIEKCAENCISTPEYNPVCGSDXKTYKNQGRLFCAQN 504 Q ++ C + T E NP S+ YKN R+ C N Sbjct: 284 QCVDACETETV-TDEANPCKFSNAAKYKNGSRIICGPN 320 >Z81112-6|CAB03277.1| 673|Caenorhabditis elegans Hypothetical protein ZC376.3 protein. Length = 673 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +1 Query: 412 ENCISTPEYNPVCGSDX-KTYKN 477 + + T EY P C SD KTYKN Sbjct: 73 DGILETKEYKPACMSDAKKTYKN 95 >Z77136-10|CAB00887.1| 673|Caenorhabditis elegans Hypothetical protein ZC376.3 protein. Length = 673 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +1 Query: 412 ENCISTPEYNPVCGSDX-KTYKN 477 + + T EY P C SD KTYKN Sbjct: 73 DGILETKEYKPACMSDAKKTYKN 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,027,979 Number of Sequences: 27780 Number of extensions: 308110 Number of successful extensions: 757 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1176726318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -