BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E15 (451 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.29 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.2 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.4 bits (53), Expect = 0.29 Identities = 17/80 (21%), Positives = 30/80 (37%) Frame = -2 Query: 384 CVSVLGPVVPAPDCPKTKLSGRNICPKGPERTESMVPGSRSTRMARGTYLPPEASL**TL 205 C+S+L V CP+ ++ + R +++ + T +A + L Sbjct: 178 CISILAIKVYYISCPEISVNFAHFPATPTGREVALIEQTIGTCVANAVVIEQPTFL---- 233 Query: 204 MRSSCKSESPWYAPVGSMPC 145 CK + WY P G C Sbjct: 234 ----CKGDGKWYLPSGGCHC 249 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 20.6 bits (41), Expect = 8.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 179 DSDLQLERINVYYNEASGGKYV 244 D+ L+ I Y N+ GG++V Sbjct: 72 DARLKFSNIAPYLNQIYGGQFV 93 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,199 Number of Sequences: 438 Number of extensions: 2312 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -