BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E11 (419 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64854-5|AAB18317.1| 422|Caenorhabditis elegans Hypothetical pr... 26 9.5 U03059-1|AAA88795.1| 422|Caenorhabditis elegans ornithine decar... 26 9.5 >U64854-5|AAB18317.1| 422|Caenorhabditis elegans Hypothetical protein K11C4.4 protein. Length = 422 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +1 Query: 259 LYKSGAGEGSRVEIDKFLGDVDYSEATNPYISLSKTFSEMNPDFFTMANK 408 L + G G G +++I G +E NP+ +++T + +FF NK Sbjct: 221 LCEIGEGLGFKMDIIDMGGGFPGAEHHNPFEKIAETIRDALDEFFPDTNK 270 >U03059-1|AAA88795.1| 422|Caenorhabditis elegans ornithine decarboxylase protein. Length = 422 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +1 Query: 259 LYKSGAGEGSRVEIDKFLGDVDYSEATNPYISLSKTFSEMNPDFFTMANK 408 L + G G G +++I G +E NP+ +++T + +FF NK Sbjct: 221 LCEIGEGLGFKMDIIDMGGGFPGAEHHNPFEKIAETIRDALDEFFPDTNK 270 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,503,074 Number of Sequences: 27780 Number of extensions: 188996 Number of successful extensions: 490 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 682028672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -