BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E08 (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77270.1 68414.m08999 expressed protein 31 0.35 At5g05970.1 68418.m00661 transducin family protein / WD-40 repea... 28 0.60 At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type f... 29 2.5 At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type f... 29 2.5 At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly ... 27 5.7 At5g42190.1 68418.m05135 E3 ubiquitin ligase SCF complex subunit... 27 7.5 At3g51560.1 68416.m05646 disease resistance protein (TIR-NBS-LRR... 27 7.5 At3g48500.1 68416.m05294 expressed protein 27 7.5 At2g39770.1 68415.m04883 GDP-mannose pyrophosphorylase (GMP1) i... 27 7.5 At3g62880.1 68416.m07064 mitochondrial import inner membrane tra... 27 9.9 At1g15200.1 68414.m01817 protein-protein interaction regulator f... 27 9.9 >At1g77270.1 68414.m08999 expressed protein Length = 682 Score = 31.5 bits (68), Expect = 0.35 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 48 TRYISDRRCANIRRNSAAVVMRVRKKLKTGL-RIRRQDLPQPVPLVLREGQDAQRFENRE 224 TRY+ D + N R + + + R K+LKT + R + + P+V + +D QR +NRE Sbjct: 390 TRYVRDSQEKNTRNDESQTIFRASKRLKTEIGRADHNSISKTNPVV--KTKDIQR-KNRE 446 >At5g05970.1 68418.m00661 transducin family protein / WD-40 repeat family protein contains similarity to regulatory protein Nedd1; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak)|19804256|gb|AV785466.1|AV785466 Length = 781 Score = 27.9 bits (59), Expect(2) = 0.60 Identities = 22/80 (27%), Positives = 34/80 (42%) Frame = +1 Query: 277 PVCGTDGNTYPNKCSLECSRPLAPSLEMKHRGECQEVKVADIQPCICTREIKQVCGSDGV 456 PV G DG +C S S + G Q VK+ D+Q +C +++K G Sbjct: 81 PVTGKDGGDSAEECLSAISFSKKGSRYICSGGTGQIVKIWDLQRKLCIKKLK---GHTST 137 Query: 457 TYGNPCLLNCAKQSNPSLSI 516 G + NC + S+S+ Sbjct: 138 ITG--VMYNCKDEHLASVSV 155 Score = 21.4 bits (43), Expect(2) = 0.60 Identities = 6/21 (28%), Positives = 12/21 (57%) Frame = +1 Query: 232 TCEEADPCVCTFIYAPVCGTD 294 + + DPCV ++ +P C + Sbjct: 27 SADSGDPCVLSYTPSPGCAVN 47 >At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 144 Score = 28.7 bits (61), Expect = 2.5 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +1 Query: 100 PSSCA--CARNLRPVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 240 P+SC C R PVCG D TY C D +++VK+G C+ Sbjct: 68 PASCPVQCFRP-DPVCGEDSVTYWCGC-----ADALCHGVRVVKQGACD 110 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +1 Query: 361 KHRGE-CQEVKVADIQPCICTREIKQVCGSDGVTYGNPC 474 K+RGE C+ + P C R VCG D VTY C Sbjct: 56 KNRGEFCEGIAKPASCPVQCFRP-DPVCGEDSVTYWCGC 93 >At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 117 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 133 PVCGSDGKTYHNQCLLYCERDKTHSDLKIVKEGTCE 240 PVCG+DG TY C D ++VK+G C+ Sbjct: 53 PVCGTDGVTYWCGC-----PDAACHGARVVKKGACD 83 >At5g44120.3 68418.m05400 12S seed storage protein (CRA1) nearly identical to SP|P15455 [Plant Mol Biol 11:805-820 (1988)]; contains Pfam profile PF00190 Cupin and Prosite 11-S plant seed storage proteins signature PS00305 Length = 472 Score = 27.5 bits (58), Expect = 5.7 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 271 YAPVCGTDGNTYPNKCSLECSRPLAPSLEMKHRGECQEVKVAD 399 YA G G +PN+C L+ L PS +K E ++V D Sbjct: 21 YAAQQGQQGQQFPNECQLDQLNALEPSHVLK--SEAGRIEVWD 61 >At5g42190.1 68418.m05135 E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At2) / UFO-binding protein (UIP2) E3 ubiquitin ligase; skp1b; identical to UIP2 GI:3719211 from [Arabidopsis thaliana]; contains Pfam profiles PF01466: Skp1 family, dimerisation domain and PF03931:Skp1 family, tetramerisation domain; identical to cDNA UFO binding protein UIP2 mRNA, partial cds GI:3719210 Length = 171 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 98 CRRHARAQET*DRSADQTARLTTTSAS 178 C+RH A E + +AD A TTT+ + Sbjct: 60 CKRHVEAAEKSETTADAAAATTTTTVA 86 >At3g51560.1 68416.m05646 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1253 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 452 PSLPQTCLISRVQIHGCISATLTSW 378 P+LPQ+ + + +HGC+S SW Sbjct: 983 PALPQS--LKLLNVHGCVSLESVSW 1005 >At3g48500.1 68416.m05294 expressed protein Length = 668 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 265 FIYAPVCGTDGNTYPNKCSLECSRPLAP 348 F + P+ DG+T P++ +C RP P Sbjct: 354 FDFPPIFHRDGDTNPDEIRRDCGRPPEP 381 >At2g39770.1 68415.m04883 GDP-mannose pyrophosphorylase (GMP1) identical to GDP-mannose pyrophosphorylase from Arabidopsis thaliana [GI:3598958]; updated per Conklin PL et al, PNAS 1999, 96(7):4198-203 Length = 361 Score = 27.1 bits (57), Expect = 7.5 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 422 RVQIHGCISATLTSWHS 372 R++ H CIS+++ WHS Sbjct: 297 RIKKHACISSSIIGWHS 313 >At3g62880.1 68416.m07064 mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein contains PFam PF02466: Mitochondrial import inner membrane translocase subunit Tim17 Length = 136 Score = 26.6 bits (56), Expect = 9.9 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +1 Query: 391 VADIQPCICTREIKQVCGSDGVTYGNPCLLNCAKQSNPS 507 VA I TR QV G G+ L NC + NP+ Sbjct: 95 VAGAAVAISTRNWTQVVGMAGLVSAFSVLANCTRTENPN 133 >At1g15200.1 68414.m01817 protein-protein interaction regulator family protein contains Pfam PF04696: pinin/SDK/memA/ protein conserved region Length = 423 Score = 26.6 bits (56), Expect = 9.9 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = +3 Query: 60 SDRRCANIRRNSAAVVMRVRKKLKTGLRIRRQDLPQPVPLVLREGQDAQRFENRER 227 SD++ + + R S + R ++ +T R LP+P P VL + +D + NR R Sbjct: 112 SDKKQSGLHRGSWS--QRDAEQRRTNKRYEAFALPEPAPRVLPKNED-PKLVNRNR 164 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,275,579 Number of Sequences: 28952 Number of extensions: 236595 Number of successful extensions: 703 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -