BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E07 (498 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0239 + 21637451-21638098,21638172-21638714 29 2.7 04_04_0423 - 25102305-25102489,25102571-25102717,25103079-251031... 28 4.8 >11_06_0239 + 21637451-21638098,21638172-21638714 Length = 396 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -1 Query: 162 SCHISLLLKLVPTIKSLHCTTHIKDRRTTNKTGATFI 52 +CH LLL ++ + CT RR G T++ Sbjct: 129 TCHSQLLLAAAGAMRGVRCTAFFSMRRVVELAGGTWV 165 >04_04_0423 - 25102305-25102489,25102571-25102717,25103079-25103150, 25103305-25103327,25103792-25103863,25104064-25104112, 25104344-25104415,25104880-25104951,25105281-25105352, 25106569-25106640,25106810-25106881,25106974-25107048, 25107324-25107470,25107598-25107805,25108361-25108489, 25108563-25108769 Length = 557 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -3 Query: 277 VCVVQIT---GNYTLYNLLPRIRKENFFNSFLQWD 182 +CV ++ G Y+ ++LLPR + FN ++W+ Sbjct: 62 LCVAKVREDIGKYSDFSLLPRDLSQQVFNELVEWN 96 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,225,747 Number of Sequences: 37544 Number of extensions: 239250 Number of successful extensions: 454 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -