BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E06 (459 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 3.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 6.4 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 3.7 Identities = 16/72 (22%), Positives = 26/72 (36%) Frame = +3 Query: 90 IILFTDSYDIMYLGTIKEILEKFKSFPDTRVLFSAEQFCWPDSKLASEYPNVEVANPYLN 269 II+ + + T+ + K P S E KL E PN + + Y N Sbjct: 125 IIVMPEKMSDEKISTLYALGAKIIRTPTEASWHSPEAHISVAQKLQKEIPNSIILDQYTN 184 Query: 270 SGGFIGYLPEVA 305 G + + + A Sbjct: 185 PGNPLAHYDQTA 196 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.0 bits (42), Expect = 6.4 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +3 Query: 216 SKLASEYPNVEVANP 260 +K +YPN ++ NP Sbjct: 723 TKYHGQYPNTQIQNP 737 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,571 Number of Sequences: 438 Number of extensions: 2284 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12189771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -