BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_E05 (515 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_1021 - 29750155-29750220,29750342-29750428,29750614-297507... 29 2.2 08_02_0969 - 23126389-23126670,23126764-23126947,23127017-231278... 28 5.1 11_04_0234 + 15187065-15188241,15188316-15188494 27 6.8 02_03_0074 + 14781763-14784191,14784888-14784978,14785180-147852... 27 8.9 01_02_0015 + 10191793-10191957,10192085-10192229,10192331-101924... 27 8.9 01_01_1179 - 9393337-9393453,9395175-9395227,9395346-9395436 27 8.9 >03_05_1021 - 29750155-29750220,29750342-29750428,29750614-29750799, 29750965-29751059,29751179-29751284,29751378-29751452, 29751548-29751679,29751782-29751961,29752371-29752567, 29752651-29752906 Length = 459 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +1 Query: 7 LVLGISTTGRTWKLDSDSEISGVPPIHADEGGEAGPYTKVQGLLSYPEICAK 162 LV+G + T L E+SG+P D GP K+ L++ E+ K Sbjct: 365 LVVGGWNSSNTSHLQEIGELSGIPSYWIDSEQRIGPGNKISYKLNHGELVEK 416 >08_02_0969 - 23126389-23126670,23126764-23126947,23127017-23127834, 23127953-23128642 Length = 657 Score = 27.9 bits (59), Expect = 5.1 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -1 Query: 359 MDTPPRFFVFT*LALFPAVSGSS*ETQKPPSPXSSGRRKA 240 M T P +A A GS +T PPSP GRR++ Sbjct: 542 MMTVPNLGTLDPMADADANDGSQMQTPAPPSPAGEGRRRS 581 >11_04_0234 + 15187065-15188241,15188316-15188494 Length = 451 Score = 27.5 bits (58), Expect = 6.8 Identities = 33/127 (25%), Positives = 50/127 (39%), Gaps = 1/127 (0%) Frame = +1 Query: 4 KLVLGISTTGRTWKL-DSDSEISGVPPIHADEGGEAGPYTKVQGLLSYPEICAKLINPNQ 180 KLV+GI GR+W L + D G P A G + G+++Y EI L Sbjct: 276 KLVMGIPLFGRSWFLRNKDKNGLGAPTAAA---GTKQRKSNQIGVIAYAEIEEYL----- 327 Query: 181 NGKRPHLRKVNDPSKRFGTYAFRLPDDXGEGGFWVSYEDPDTAGNKASYVKTKNLGGVSI 360 K + +D ++ Y + G WVS++ K +V L G + Sbjct: 328 --KSQSVFVTHD-NQSVADYFY-------SGDLWVSFDSAVVVQEKVEFVAKSQLLGYFL 377 Query: 361 MDLSMDD 381 +S DD Sbjct: 378 STISFDD 384 >02_03_0074 + 14781763-14784191,14784888-14784978,14785180-14785230, 14785882-14785947,14786509-14786610 Length = 912 Score = 27.1 bits (57), Expect = 8.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 289 KKPRSHLHHXHQEGGRHR 236 ++P+SH HH H G R R Sbjct: 164 QQPQSHHHHHHHSGSRKR 181 >01_02_0015 + 10191793-10191957,10192085-10192229,10192331-10192419, 10193009-10193063,10193607-10193692,10194006-10194065 Length = 199 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 295 DPDTAGNKASYVKTKNLGGVSIMDLSMDDFRGLCTGDK 408 D + G A + G ++ ++D+FR LCTGDK Sbjct: 71 DVEVGGEPAGRIVIGLFG--EVVPKTVDNFRALCTGDK 106 >01_01_1179 - 9393337-9393453,9395175-9395227,9395346-9395436 Length = 86 Score = 27.1 bits (57), Expect = 8.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 160 KLINPNQNGKRPHLRK 207 K I PN++GK PH+RK Sbjct: 15 KTIPPNRHGKAPHVRK 30 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,196,340 Number of Sequences: 37544 Number of extensions: 335696 Number of successful extensions: 843 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 843 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -