BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D19 (478 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43990.2 68418.m05382 SET domain-containing protein identical... 33 0.13 At5g43990.1 68418.m05383 SET domain-containing protein identical... 33 0.13 At5g40480.1 68418.m04909 expressed protein ; expression supporte... 30 0.70 At1g77550.1 68414.m09030 tubulin-tyrosine ligase family protein ... 27 6.6 At1g12120.1 68414.m01404 expressed protein contains Pfam domain ... 27 6.6 At4g28760.2 68417.m04113 expressed protein predicted protein. Ar... 27 8.7 At4g28760.1 68417.m04112 expressed protein predicted protein. Ar... 27 8.7 At3g05150.1 68416.m00559 sugar transporter family protein simila... 27 8.7 >At5g43990.2 68418.m05382 SET domain-containing protein identical to SET domain protein SUVR2 [Arabidopsis thaliana] GI:15290521; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif; identical to cDNA SET domain protein SUVR2 GI:15290520 Length = 740 Score = 32.7 bits (71), Expect = 0.13 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 1/78 (1%) Frame = +1 Query: 124 TSSRVRRQAGELTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQIKLGAATAGLVYD 303 ++ V +AGE +DGT+ + + +HKL+A +++ ++L ++ +G V Sbjct: 219 SNGHVEEKAGETVSTADGTTNDISPTTVARFSDHKLAA--TIEEPPALELASSASGEVKI 276 Query: 304 NVNRHGAT-LTNTHIPGI 354 N++ AT +N H+P + Sbjct: 277 NLSFAPATGGSNPHLPSM 294 >At5g43990.1 68418.m05383 SET domain-containing protein identical to SET domain protein SUVR2 [Arabidopsis thaliana] GI:15290521; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif; identical to cDNA SET domain protein SUVR2 GI:15290520 Length = 717 Score = 32.7 bits (71), Expect = 0.13 Identities = 20/78 (25%), Positives = 42/78 (53%), Gaps = 1/78 (1%) Frame = +1 Query: 124 TSSRVRRQAGELTINSDGTSGAMVKVPITGNENHKLSALGSVDLTNQIKLGAATAGLVYD 303 ++ V +AGE +DGT+ + + +HKL+A +++ ++L ++ +G V Sbjct: 196 SNGHVEEKAGETVSTADGTTNDISPTTVARFSDHKLAA--TIEEPPALELASSASGEVKI 253 Query: 304 NVNRHGAT-LTNTHIPGI 354 N++ AT +N H+P + Sbjct: 254 NLSFAPATGGSNPHLPSM 271 >At5g40480.1 68418.m04909 expressed protein ; expression supported by MPSS Length = 1919 Score = 30.3 bits (65), Expect = 0.70 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 262 QIKLGAATAGLVYDNVNRHGATLTNTHIPGIGDKLSVAGKVNLFHNNDH 408 Q K+ +Y V+ G TLTN H+P G K V + N F +H Sbjct: 1597 QTKVTVLFGNTIY--VDSPGETLTNVHVPAEGYKFPVKFRENKFAVTEH 1643 >At1g77550.1 68414.m09030 tubulin-tyrosine ligase family protein contains tubulin-tyrosine ligase family domain, Pfam:PF03133 Length = 867 Score = 27.1 bits (57), Expect = 6.6 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 382 VNLFHNNDHDLSAKAFATRNMPTISHL 462 ++L + + H+L KAF+ MP +SHL Sbjct: 281 LDLSNRSIHNLVNKAFSVHEMPLLSHL 307 >At1g12120.1 68414.m01404 expressed protein contains Pfam domain PF05904: Plant protein of unknown function (DUF863) Length = 483 Score = 27.1 bits (57), Expect = 6.6 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 2/67 (2%) Frame = +1 Query: 250 DLTNQIKLGAATAGLVYDNVNRH--GATLTNTHIPGIGDKLSVAGKVNLFHNNDHDLSAK 423 D ++ ++G A G YD+ RH G + TNT +++ N+ +N+ ++ K Sbjct: 347 DFPDKPEMGKAKPGCSYDSYERHTLGISETNTEEDFCVSSMALDELNNITRDNNKEIGLK 406 Query: 424 AFATRNM 444 R M Sbjct: 407 LRRGRRM 413 >At4g28760.2 68417.m04113 expressed protein predicted protein. Arabidopsis thaliana Length = 924 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 125 PVPGCAGKRVNL 160 PVPGC GK VNL Sbjct: 15 PVPGCLGKMVNL 26 >At4g28760.1 68417.m04112 expressed protein predicted protein. Arabidopsis thaliana Length = 924 Score = 26.6 bits (56), Expect = 8.7 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 125 PVPGCAGKRVNL 160 PVPGC GK VNL Sbjct: 15 PVPGCLGKMVNL 26 >At3g05150.1 68416.m00559 sugar transporter family protein similar to sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 470 Score = 26.6 bits (56), Expect = 8.7 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +1 Query: 226 KLSALGSVDLTNQIKLGAATAGLVYDNVNRHGATLTNTHIPGIG 357 + S GS+ L LGA T+G + D + R GA ++ I IG Sbjct: 73 QFSVFGSI-LNMGAVLGAITSGKISDFIGRKGAMRLSSVISAIG 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,174,943 Number of Sequences: 28952 Number of extensions: 192658 Number of successful extensions: 454 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 821630280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -