BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D18 (577 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 24 1.1 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 2.5 DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 22 3.3 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.5 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.9 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 23.8 bits (49), Expect = 1.1 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 96 QYSETALLYDELIGSVDQRTYEYKHFFGDILRANGCLKVLDVACGTGVDSMLLL 257 +++ET ++ L S DQ Y Y+ + C+ VL ACG+ + + LLL Sbjct: 478 EWAETTIIPKVLAMSRDQN-YLYR------MTCLFCINVLAEACGSDITTRLLL 524 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.6 bits (46), Expect = 2.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 232 LVLIQCCCWSKDLN 273 + LI CCW K L+ Sbjct: 7 IYLIVACCWGKSLS 20 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 481 VNRRRAYLNFVKCLKPGGFTTGRS*EL 561 +N R N++KCL G T EL Sbjct: 36 LNNDRVLTNYIKCLMDEGPCTSEGREL 62 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 546 TSSKPAGFQAFYEV 505 T +K +GF A+YEV Sbjct: 360 TYTKESGFLAYYEV 373 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 20.6 bits (41), Expect = 9.9 Identities = 6/18 (33%), Positives = 9/18 (50%) Frame = -1 Query: 298 CSEPSVETNSNPCSNSNI 245 C + +SNPC N + Sbjct: 373 CEFSGYDCDSNPCQNGGV 390 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,506 Number of Sequences: 336 Number of extensions: 2980 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -