BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D16 (427 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 26 0.15 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 26 0.20 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 26 0.20 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 25 0.35 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 2.5 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 2.5 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 22 3.3 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 3.3 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 21 4.4 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 21 4.4 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 26.2 bits (55), Expect = 0.15 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 228 CTCPDGVDPYLGDSISELNFDV 293 C G+D D I+E+NFDV Sbjct: 33 CKAESGIDQQTVDDINEVNFDV 54 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 25.8 bits (54), Expect = 0.20 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 228 CTCPDGVDPYLGDSISELNFDV 293 C G+D D I+E+NFDV Sbjct: 33 CKTESGIDQQTVDDINEVNFDV 54 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.8 bits (54), Expect = 0.20 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 242 VWTGTGADLSVTSEPERRGF 183 VW GADL +EPE R F Sbjct: 343 VWRRNGADLETLNEPEIRVF 362 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.0 bits (52), Expect = 0.35 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 339 KNNESSSLF*IKKTIHWFQFFHIVKKKK 422 K+++SS ++ +HW FF KK++ Sbjct: 446 KSSKSSGWRKLRNIVHWTPFFQTYKKQR 473 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 2.5 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = +3 Query: 369 IKKTIHWFQFFHIVKKKK 422 ++ +HW FF KK++ Sbjct: 222 LRNIVHWTPFFQTYKKQR 239 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 2.5 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = +3 Query: 369 IKKTIHWFQFFHIVKKKK 422 ++ +HW FF KK++ Sbjct: 137 LRNIVHWTPFFQTYKKQR 154 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 21.8 bits (44), Expect = 3.3 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 210 YTEVCTCTCPDGVDPYLGDSISELNFDV 293 +TE C G+D + + E N DV Sbjct: 27 HTEQSVCKTETGIDQQKANDVIEGNIDV 54 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.8 bits (44), Expect = 3.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 27 RNEMSKFTILAVLLGLV 77 +N + FTI AVL+GL+ Sbjct: 62 KNMLLVFTIAAVLVGLI 78 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 21.4 bits (43), Expect = 4.4 Identities = 9/33 (27%), Positives = 14/33 (42%) Frame = +3 Query: 150 CVHLGSGCEKLKSSPFWFGSYTEVCTCTCPDGV 248 C + C L S + + +C CPDG+ Sbjct: 36 CQAVNGHCSHLCLPAPRINSKSPLLSCACPDGL 68 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 21.4 bits (43), Expect = 4.4 Identities = 9/33 (27%), Positives = 14/33 (42%) Frame = +3 Query: 150 CVHLGSGCEKLKSSPFWFGSYTEVCTCTCPDGV 248 C + C L S + + +C CPDG+ Sbjct: 36 CQAVNGHCSHLCLPAPRINSKSPLLSCACPDGL 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,802 Number of Sequences: 438 Number of extensions: 2347 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10997463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -