BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D15 (530 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.05 |||thiamine transporter |Schizosaccharomyces pombe|c... 26 3.0 SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces po... 26 3.0 SPAC3C7.07c |||arginine-tRNA protein transferase |Schizosaccharo... 25 7.0 >SPBC1683.05 |||thiamine transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 559 Score = 26.2 bits (55), Expect = 3.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 383 HLWIVGYFYLNNICFIIVYILNI 451 HL+ +GYFY F+I + LN+ Sbjct: 497 HLYYIGYFYSFMTAFLIYWGLNL 519 >SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces pombe|chr 2|||Manual Length = 1014 Score = 26.2 bits (55), Expect = 3.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 206 TRSNRDISNSF*GFRNNHSNCN 271 TR R S +F GF +NHSN N Sbjct: 965 TRPRRLGSRTFQGFNSNHSNIN 986 >SPAC3C7.07c |||arginine-tRNA protein transferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 Query: 346 PDLCALQMEDVNPPLDSWLFLFE*YMLYYSLYFKHIC 456 PD+ + ++ + WL L Y YY Y+ H C Sbjct: 187 PDMSKFSLGRISACREIWLALECGYRYYYMGYYIHTC 223 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,042,271 Number of Sequences: 5004 Number of extensions: 40004 Number of successful extensions: 90 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 218398248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -