BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D14 (442 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.28 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 24 0.65 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 2.0 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 6.0 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 6.0 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 6.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 6.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 6.0 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 6.0 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 6.0 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 7.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 7.9 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 7.9 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 25.4 bits (53), Expect = 0.28 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 185 YYTPERNPKEADYTAPIYAPQN 250 Y+ E++PK+ T P APQN Sbjct: 302 YFRAEKDPKKMPCTQPPSAPQN 323 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 24.2 bits (50), Expect = 0.65 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 281 INYWIQNGAPTHKLVLGIST--TGRTWKLDSDSEISGV 388 +++WI A + ++ LGI+T T T LDS +++ V Sbjct: 264 VSFWIHREATSDRVGLGITTVLTLSTISLDSRTDLPKV 301 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.6 bits (46), Expect = 2.0 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +2 Query: 281 INYWIQNGAPTHKLVLGIST 340 +++WI + A + ++ LGI+T Sbjct: 261 VSFWINHEATSARVALGITT 280 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 6.0 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +2 Query: 281 INYWIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADKGGE 418 +++W+ A ++VLG +T L S E + +P + K E Sbjct: 251 VSFWLHMDASPPRIVLGTNTILTFMTLASKVE-NSLPKVSYIKASE 295 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 6.0 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +2 Query: 281 INYWIQNGAPTHKLVLGIST 340 +++W+ A ++ LG++T Sbjct: 240 VSFWLNRNATPARVALGVTT 259 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 6.0 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +2 Query: 281 INYWIQNGAPTHKLVLGIST 340 +++W+ A ++ LG++T Sbjct: 240 VSFWLNRNATPARVALGVTT 259 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 6.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 78 ICS*LSAFCQT*IAPFTLTS 137 IC+ L+A CQ + F +TS Sbjct: 644 ICTKLTADCQPGVTAFIVTS 663 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 6.0 Identities = 17/75 (22%), Positives = 30/75 (40%), Gaps = 8/75 (10%) Frame = +2 Query: 8 ESEHREGFTALVREMKQALNVKPNMQLVISVLPNV-NSSIYFDV--PSIINLV-----DI 163 E +H+ F + + + P ++ SV N++ Y P ++ D+ Sbjct: 279 EQQHKAMFLVVTAQPVHSAYKAPEETIISSVFTTRHNATCYLSHVDPDVVQYFGYLPQDM 338 Query: 164 VNIQAFDYYTPERNP 208 V FD+Y PE P Sbjct: 339 VGRSLFDFYHPEDLP 353 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.0 bits (42), Expect = 6.0 Identities = 5/20 (25%), Positives = 13/20 (65%) Frame = +2 Query: 281 INYWIQNGAPTHKLVLGIST 340 +++W+ A ++ LG++T Sbjct: 179 VSFWLNRNATPARVALGVTT 198 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 6.0 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -3 Query: 275 RRRFVEDRGSAVRKSVQCSPPLWGYVQVY 189 R+ + EDR +R+ P + QVY Sbjct: 14 RQVYGEDRWEEIRRQASVEQPSFSVHQVY 42 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.6 bits (41), Expect = 7.9 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = +2 Query: 281 INYWIQNGAPTHKLVLGIST 340 +++W+ A ++ LGI+T Sbjct: 233 VSFWLNREATADRVSLGITT 252 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/23 (30%), Positives = 11/23 (47%) Frame = +2 Query: 359 LDSDSEISGVPPIHADKGGEAGP 427 + D + G+ P+H G GP Sbjct: 53 IPGDIVLGGLFPVHEKGGASCGP 75 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 158 DIVNIQAFDYYTPERNP 208 D+V FD+Y PE P Sbjct: 43 DMVGRSLFDFYHPEDLP 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,064 Number of Sequences: 438 Number of extensions: 2351 Number of successful extensions: 17 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -