BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D10 (405 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 20 9.3 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 20 9.3 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 20.2 bits (40), Expect = 9.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 200 ISALSLGATDETLNEINVV 256 I SLGA+DE + +++ + Sbjct: 359 IGLASLGASDEEIEKLSTI 377 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/32 (25%), Positives = 14/32 (43%) Frame = -1 Query: 381 HSFSKSVNIAPESFKTPPSFSPISFKILKYFL 286 H + +A +KT F PI + + +L Sbjct: 908 HQGQIHLTVAVVQYKTQDGFGPIHYGVCSNYL 939 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,199 Number of Sequences: 438 Number of extensions: 1815 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10132494 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -