BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D08 (477 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2435| Best HMM Match : WD40 (HMM E-Value=4.1e-10) 33 0.12 SB_55406| Best HMM Match : DUF1534 (HMM E-Value=0.45) 30 1.1 SB_45142| Best HMM Match : Herpes_IE68 (HMM E-Value=3.8) 29 2.6 SB_35595| Best HMM Match : AT_hook (HMM E-Value=3.7) 29 2.6 SB_35108| Best HMM Match : AT_hook (HMM E-Value=0.15) 29 2.6 SB_34667| Best HMM Match : AT_hook (HMM E-Value=3.7) 29 2.6 SB_32994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_23956| Best HMM Match : AT_hook (HMM E-Value=3.7) 29 2.6 SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11) 29 2.6 SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) 29 2.6 SB_7962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53291| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_42307| Best HMM Match : AT_hook (HMM E-Value=3.7) 29 2.6 SB_33158| Best HMM Match : rve (HMM E-Value=7.5e-05) 29 2.6 SB_59443| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) 28 3.4 SB_52167| Best HMM Match : Extensin_2 (HMM E-Value=3.6) 28 3.4 SB_40649| Best HMM Match : AT_hook (HMM E-Value=3.7) 28 3.4 SB_40783| Best HMM Match : MH2 (HMM E-Value=0) 28 3.4 SB_15995| Best HMM Match : DUF1388 (HMM E-Value=3.9e-12) 27 6.0 SB_29958| Best HMM Match : Pkinase (HMM E-Value=2.6e-08) 27 7.9 >SB_2435| Best HMM Match : WD40 (HMM E-Value=4.1e-10) Length = 1272 Score = 33.1 bits (72), Expect = 0.12 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Frame = +2 Query: 17 NSGY*VVYIKMEGSHKLNSRNDHIHNGEGTATENR----RAPPPPYVSVEAQP-VNVVTS 181 ++G+ IK++GS +L RN + AT + R PPPP S E QP +N S Sbjct: 1110 STGHDQYKIKVDGSGRLTKRNSRVLRAYAPATPSPDHQYRTPPPPPRSPECQPTLNSSPS 1169 Query: 182 SKYY 193 + Y Sbjct: 1170 PRTY 1173 >SB_55406| Best HMM Match : DUF1534 (HMM E-Value=0.45) Length = 248 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +2 Query: 56 SHKLNSRNDHIHNGEGTAT--ENRRAPPPPYVSVEAQPVNV 172 +H ND G+ T E PPPPY ++E PV + Sbjct: 176 THDPRHSNDRPPRGDSIVTQLEGPNEPPPPYSTLERSPVTI 216 >SB_45142| Best HMM Match : Herpes_IE68 (HMM E-Value=3.8) Length = 292 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 184 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 228 >SB_35595| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 214 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 60 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 104 >SB_35108| Best HMM Match : AT_hook (HMM E-Value=0.15) Length = 1600 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 817 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 861 >SB_34667| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 240 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 86 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 130 >SB_32994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 513 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 557 >SB_23956| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 240 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 86 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 130 >SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11) Length = 1213 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 1059 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 1103 >SB_9550| Best HMM Match : GPS (HMM E-Value=1.6e-11) Length = 1771 Score = 28.7 bits (61), Expect = 2.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 86 IHNGEGTATENRRAPPPPYVSVE 154 +H+ G++ E+ + PPP YVS E Sbjct: 897 MHHENGSSMESEQKPPPSYVSTE 919 >SB_7962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1269 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 1115 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 1159 >SB_53291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 523 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 567 >SB_42307| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 269 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 115 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 159 >SB_33158| Best HMM Match : rve (HMM E-Value=7.5e-05) Length = 848 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 694 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQP 738 >SB_59443| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) Length = 942 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTATENR----RAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 798 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQFRTPPPPPRSPECQP 842 >SB_52167| Best HMM Match : Extensin_2 (HMM E-Value=3.6) Length = 287 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTAT----ENRRAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 133 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPERQP 177 >SB_40649| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 240 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = +2 Query: 41 IKMEGSHKLNSRNDHIHNGEGTATENR----RAPPPPYVSVEAQP 163 IK++GS +L RN AT R PPPP S E QP Sbjct: 86 IKVDGSGRLTLRNRRFLRAYTPATPTPDHQFRTPPPPPRSPECQP 130 >SB_40783| Best HMM Match : MH2 (HMM E-Value=0) Length = 494 Score = 28.3 bits (60), Expect = 3.4 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 4/99 (4%) Frame = +2 Query: 80 DHIHNGEGTATENRRAPPPPYVSVEAQPVN---VVTSSKYYDSYTCCGIFPLKTGCLIIG 250 D +G G +E+ +P P +++ PVN ++ S S+ + I Sbjct: 182 DMADSGAGYMSEDGGSPRPEPNAMDVDPVNSPPSISQSAEAMSHVTAVNYQEPLSWCSIA 241 Query: 251 YYNLVSAVCXXXXXXXXXXXXNNYMDPN-NNTEKRNLGL 364 YY L + V + + DPN N+E+ LGL Sbjct: 242 YYELNNRVGELFHAKSTSLIVDGFTDPNTTNSERFCLGL 280 >SB_15995| Best HMM Match : DUF1388 (HMM E-Value=3.9e-12) Length = 1108 Score = 27.5 bits (58), Expect = 6.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 47 MEGSHKLNSRNDHIHNGEGTATENRRAPPP 136 M+G S D I N GT +EN PPP Sbjct: 803 MQGESNFQSAIDDIDNILGTTSENVENPPP 832 >SB_29958| Best HMM Match : Pkinase (HMM E-Value=2.6e-08) Length = 857 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 441 PTTSNIVNIKCNARNIINIEQNITKVKP 358 PTTS++V IKC R + +N + P Sbjct: 769 PTTSHVVYIKCANRTHLRFRRNPVRTAP 796 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,262,935 Number of Sequences: 59808 Number of extensions: 300196 Number of successful extensions: 846 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -