BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D08 (477 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC125070-1|AAI25071.1| 587|Homo sapiens chromosome 14 open read... 30 3.6 AK098187-1|BAC05253.1| 587|Homo sapiens protein ( Homo sapiens ... 30 3.6 >BC125070-1|AAI25071.1| 587|Homo sapiens chromosome 14 open reading frame 39 protein. Length = 587 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -1 Query: 444 TPTTSNIVNIKCNARNIINIEQNITKVKPKLRFSV 340 T T NIVN++C ++I+ N+TK +L+ V Sbjct: 179 TKWTLNIVNLRCETQDILKHASNLTKSSSELKKEV 213 >AK098187-1|BAC05253.1| 587|Homo sapiens protein ( Homo sapiens cDNA FLJ40868 fis, clone TSTOM1000186. ). Length = 587 Score = 30.3 bits (65), Expect = 3.6 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -1 Query: 444 TPTTSNIVNIKCNARNIINIEQNITKVKPKLRFSV 340 T T NIVN++C ++I+ N+TK +L+ V Sbjct: 179 TKWTLNIVNLRCETQDILKHASNLTKSSSELKKEV 213 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,647,544 Number of Sequences: 237096 Number of extensions: 1484869 Number of successful extensions: 3094 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2981 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3094 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4213781852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -