BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D06 (666 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 3.4 SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) 29 3.4 SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) 28 5.9 SB_17184| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 500 LAMCSVQHLNHSTSTPSCPVRLTFTKPHFET 592 L+ CS+Q L +T T P+R++F++PH T Sbjct: 1421 LSTCSLQSLTDNT-TSERPIRISFSEPHLHT 1450 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (4%) Frame = +1 Query: 214 TGYYPLMT-SYYFPF--AQRPDNYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKK 384 T Y P T S Y Q+P+N++LH +A+ T L GKF+S G+ Sbjct: 4715 TSYQPAATDSLYISSQSTQKPNNHHLHRTCKADALEV----NVTLRGGLHAGKFKSVGRT 4770 Query: 385 IDFHD 399 D H+ Sbjct: 4771 RDVHE 4775 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 406 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRCVDC 275 P H NQ C IC+ G KS KCP L S RC C Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARCTLC 288 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +1 Query: 349 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 480 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_19503| Best HMM Match : Kinesin (HMM E-Value=9.5e-14) Length = 869 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +2 Query: 89 LSIAVAKYITISTNN*QHVITS-SVLQTAWVPYLNSLGTRLLR 214 + +A AKYI +S + + VI + S + +PY NS+ T +LR Sbjct: 165 IQLAEAKYINVSLHFLEQVIVALSEKSRSHIPYRNSMMTSVLR 207 >SB_43557| Best HMM Match : Pentapeptide (HMM E-Value=8.1e-11) Length = 129 Score = 28.3 bits (60), Expect = 5.9 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = +2 Query: 479 NDLMKLSLAMCSVQHLN--HSTSTPSCPVRLTFTKPHFETLHSISYITGLWVTLTHSSIT 652 ++L +L ++ HLN HST T S LT T + TL +++T + T+THS++T Sbjct: 25 SNLTHSTLTHSNLTHLNLTHSTLTYSTLTHLTLT---YSTL---THLTITYSTITHSTLT 78 >SB_17184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 28.3 bits (60), Expect = 5.9 Identities = 32/146 (21%), Positives = 60/146 (41%), Gaps = 4/146 (2%) Frame = +1 Query: 67 SSERYGNLKHRRGEIYYNFYQQLTTRYYFERLTNGLGSIPEFSWYSPIKTGYYPLMTSYY 246 S ER ++RG Y Y++ R Y G E + K GY Y Sbjct: 124 SYERSYERSYKRG--YERSYERSYERGYKRSYERGNKRSYERGYKRGYKRGYERGYERSY 181 Query: 247 FPFAQRP--DNYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHDEKAI--N 414 +R +Y V++YE + +++++ +S ++ SY + + E++ + Sbjct: 182 KRSYERSYERSYKRSYVRSYER-SYKRSYKRSYKRSYKRSYKRSYKRSYERSYERSYKRS 240 Query: 415 FVGNYWQENADLYEEEVTKDYQRSYE 492 + +Y + YE + Y+RSYE Sbjct: 241 YKRSYERSYERSYERSYERSYERSYE 266 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,666,632 Number of Sequences: 59808 Number of extensions: 440790 Number of successful extensions: 1256 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1249 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -