BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D03 (518 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 2.8 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 2.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.7 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.7 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 2.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 392 RLARYYKTKSVLPPNWK 442 RL Y T+SVL +WK Sbjct: 159 RLRMYINTESVLDGDWK 175 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 22.2 bits (45), Expect = 2.8 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 208 LCNTMRVPEHDTDLGRSKTLFAKFEDLFL 122 +CN+ E +T +T+FA F D + Sbjct: 444 ICNSFTKFEFNTVFNDQRTVFANFYDAMI 472 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 8.7 Identities = 13/44 (29%), Positives = 16/44 (36%) Frame = +1 Query: 181 AQGLSWCCTSQICYW*KDPAYHESYGSCS*STGRFVLPDQEGCR 312 A GL W +IC W K E ST + P + R Sbjct: 1132 AGGLHWNKERKICDWPKSAKCEEKKPGHKPSTSSWQKPTKPSYR 1175 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 58 PVGAAVPPQCP 90 PVG A+PP P Sbjct: 120 PVGVALPPTLP 130 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,812 Number of Sequences: 336 Number of extensions: 2371 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12468463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -