BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D03 (518 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles ... 280 2e-77 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 4.7 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 4.7 >U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S13 mRNA, complete cds. ). Length = 151 Score = 280 bits (687), Expect = 2e-77 Identities = 130/151 (86%), Positives = 145/151 (96%) Frame = +2 Query: 23 MGRMHAPGKGISQSALPYRRSVPTWLKLTADDVKEQIFKLGKKGLTPSQIGVMLRDSHGV 202 MGRMHAPGKGIS+SALPYRRSVP+WLKL+A+DVKEQI KLGKKG+TPSQIG++LRDSHGV Sbjct: 1 MGRMHAPGKGISKSALPYRRSVPSWLKLSAEDVKEQIKKLGKKGMTPSQIGIILRDSHGV 60 Query: 203 AQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKKAVAMRKHLERNRKDKDSKFRLILVES 382 AQVRFV G K+LRIMKA+GL PD+PEDLY+LIKKAV++RKHLERNRKD DSKFRLIL+ES Sbjct: 61 AQVRFVNGNKVLRIMKAVGLKPDIPEDLYFLIKKAVSIRKHLERNRKDIDSKFRLILIES 120 Query: 383 RIHRLARYYKTKSVLPPNWKYESSTASALVA 475 RIHRLARYYK K+VLPPNWKYESSTASALVA Sbjct: 121 RIHRLARYYKIKAVLPPNWKYESSTASALVA 151 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +2 Query: 197 GVAQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKK 304 G++ V+F+T ++ I +MG+ L D Y+ ++ Sbjct: 443 GMSTVKFITYQEASEISGSMGVGWSLQVDCVYIDRR 478 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +2 Query: 197 GVAQVRFVTGKKILRIMKAMGLAPDLPEDLYYLIKK 304 G++ V+F+T ++ I +MG+ L D Y+ ++ Sbjct: 444 GMSTVKFITYQEASEISGSMGVGWSLQVDCVYIDRR 479 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,908 Number of Sequences: 2352 Number of extensions: 10878 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -