BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D01 (636 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-... 27 3.0 SPAC4F10.18 |||WD repeat protein, human NUP37 family|Schizosacch... 25 6.9 SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.1 SPCC550.01c |||CHCH domain protein |Schizosaccharomyces pombe|ch... 25 9.1 >SPBC16H5.05c |cyp7|cwf27|cyclophilin family peptidyl-prolyl cis-trans isomerase Cyp7|Schizosaccharomyces pombe|chr 2|||Manual Length = 463 Score = 26.6 bits (56), Expect = 3.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 3 GLYCGKNEGGNSHYFCSLIGGRQLPSRQT*F 95 G+ C +NEG NS +F +L + +QT F Sbjct: 100 GMACTENEGNNSQFFITLGPTPEWNGKQTLF 130 >SPAC4F10.18 |||WD repeat protein, human NUP37 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 391 Score = 25.4 bits (53), Expect = 6.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 482 YQMIINVKPYY*NWC 526 YQ+ +NV+PY WC Sbjct: 8 YQLPLNVRPYTTTWC 22 >SPAC22H10.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 646 Score = 25.0 bits (52), Expect = 9.1 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 281 HSPSPTFR-SVSLCSQL*LFMTQTLPKDFGFSPFLLAQ 171 H P F + +L QL +F + PKD GFS L +Q Sbjct: 99 HPFYPVFEVNSNLYYQLLMFTNYSNPKDNGFSKLLFSQ 136 >SPCC550.01c |||CHCH domain protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 77 Score = 25.0 bits (52), Expect = 9.1 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 246 QRYTAESRRWRVCWFRRNSPLLI*TTKPQWNLS 344 ++ T + +R CW +R+ PL + K NLS Sbjct: 45 RKCTEQMEEFRKCWEKRHGPLPSISDKKNKNLS 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,512,443 Number of Sequences: 5004 Number of extensions: 48720 Number of successful extensions: 100 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -