BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_D01 (636 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 25 0.47 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 24 1.4 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 4.3 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.4 bits (53), Expect = 0.47 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = -3 Query: 295 RRNQHTRHRRLSAVYLCVHSYNYS*HKRCQRTSVSLRSYWRRSVRTSRWYSREDTLSY 122 + N+ T HR + AV + K+ +S SLRS R RTS +SR + L + Sbjct: 182 KTNEITEHRTVLAVNIEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDLRH 239 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 508 RFHIDYHLVNA*I*NTFTCQKVLYRALHMTKL 413 + H++YHL N F C+K Y ++ + L Sbjct: 1 KHHLEYHLRNHFGSKPFKCEKCSYSCVNKSML 32 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 4.3 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +1 Query: 61 VAVSCRPDKPDLKQLKAEAARKKACLHDCTNVKFEPICA-SKNGEKPKSFGSVCVMNNYN 237 V++S P +P ++ ++ + FEP S++ ++ K S NYN Sbjct: 133 VSLSSPPREPGTPRINFTKLKRHHPRYKRPRTTFEPRATDSRHYDRYKEEES---NENYN 189 Query: 238 CEHKDT 255 EHK+T Sbjct: 190 WEHKET 195 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,076 Number of Sequences: 438 Number of extensions: 3929 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -