BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C19 (459 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 24 0.59 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 4.2 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 24.2 bits (50), Expect = 0.59 Identities = 13/47 (27%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +3 Query: 300 HSVHSVG-----GQTRWQACRARWSVAEWSATLHWTFCFQRVSPAQD 425 HS H G G+T RW E +W FC +R + + + Sbjct: 315 HSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDE 361 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 4.2 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +1 Query: 175 TRTVLLKSRKSFYPTQ----DKIRGRSHGTSFSKHVRRTRPNLTPG 300 TRT L +R S YP Q + H + H+++ P PG Sbjct: 256 TRTTLKNNRASPYPMQRPKSASLSPPPHVYNPPDHIQQATPYSAPG 301 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,869 Number of Sequences: 336 Number of extensions: 2367 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10511300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -