BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C18 (473 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43823| Best HMM Match : MAM (HMM E-Value=0) 30 1.1 SB_31607| Best HMM Match : NOG1 (HMM E-Value=0.74) 27 7.9 SB_22167| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = +3 Query: 99 NKVKSY--ICQGYYGCEKCCVHLGSGCEKLKSSPFWFGSYTEVCTCTCPDGVDP-YLGDS 269 +++K Y +C Y +G K SP W GS TCP G+ P +GD+ Sbjct: 1497 DQIKRYCGVCYPGYCSRHGTCSSNNGTRTCKCSPSWSGSVCSKLNITCPAGLIPCAVGDN 1556 >SB_31607| Best HMM Match : NOG1 (HMM E-Value=0.74) Length = 146 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -1 Query: 152 TAFLATVVSLAYVGLHFITVDVSQGYEAQ*NSQDCEFRHFVPRSL 18 +AF+ T+ L +F + +S GY+ + Q CE+R + + L Sbjct: 28 SAFITTLCQLKDAIYYFNDMTLSAGYKRCSSRQKCEYRMYKKKEL 72 >SB_22167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1612 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 249 RLRLDRYRCRPQCNFRTRT 193 +L LD C P CNF T+T Sbjct: 141 KLYLDNTYCHPSCNFPTKT 159 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,830,710 Number of Sequences: 59808 Number of extensions: 259616 Number of successful extensions: 664 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 608 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -