BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C16 (565 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 21 7.3 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 21 9.6 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 21.0 bits (42), Expect = 7.3 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = +3 Query: 132 WIHPEIDNPEYTPDSNLYKRDEICSVGLDLWQVKSGTIF 248 W IDN D+ Y D CS +D T+F Sbjct: 197 WYSQTIDNSYQFCDNLQYSFDNQCSGTIDWALPNKRTVF 235 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 20.6 bits (41), Expect = 9.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 68 VDHRWFPLSIHLIIPIFR 15 VD + F LS ++IP+FR Sbjct: 3 VDMQLFVLSPIILIPLFR 20 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,231 Number of Sequences: 336 Number of extensions: 1799 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -