BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C13 (557 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 23 2.8 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 4.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 6.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 6.4 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 Query: 408 GPSCSNFPWSFVGTS 364 G C N W FVG S Sbjct: 410 GTICENSAWGFVGNS 424 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 4.8 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -1 Query: 248 KKTTATCQAEIPSKTLPVLLY 186 KKT EIP+ TLP Y Sbjct: 352 KKTRLRWMMEIPNVTLPTSTY 372 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 6.4 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 452 IFNLVS-ALPSCSKTVAHPARTFHGALSAPQNTCYALS 342 IF ++ + S S VA+ R FH +P +T ALS Sbjct: 70 IFGVIGGSYSSVSLQVANLLRLFHIPQISPASTAKALS 107 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 6.4 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -1 Query: 452 IFNLVS-ALPSCSKTVAHPARTFHGALSAPQNTCYALS 342 IF ++ + S S VA+ R FH +P +T ALS Sbjct: 160 IFGVIGGSYSSVSLQVANLLRLFHIPQISPASTAKALS 197 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,863 Number of Sequences: 438 Number of extensions: 3356 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -