BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C12 (599 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.57 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.3 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 2.3 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 4.0 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 5.3 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 22 5.3 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 5.3 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 7.0 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 7.0 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 7.0 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.0 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 9.2 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.2 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 9.2 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 25.0 bits (52), Expect = 0.57 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 244 EESHQGPS*NKSSSRKTASSHQGKC---WLCLHPWR 342 + QGP + + + + S H C W+C H WR Sbjct: 350 QSKDQGPPNDGNGNILSPSIHDNICSNGWICEHRWR 385 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 217 CAHGQKHHDEESHQGPS*NKSSSRKTASS 303 C G+ HD++ P + SSS ++A S Sbjct: 430 CLDGKLPHDDQPPLSPQSDSSSSSRSAES 458 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 475 EERSLLRTKASVMSGNDDRQW 413 E R LRT A++++ N+ R W Sbjct: 1177 ELRPYLRTAAAILTWNEKRFW 1197 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +3 Query: 12 FVLSLNFSEVPTSLNPRWVGRTRLPGSPITSLKSSNCWTNTQNVS 146 FV+ + F+ VP+SLN + G P+ + W +N S Sbjct: 75 FVIIMKFNGVPSSLNV--ITNKTGNGGPLLAPYPDWTWAKNENCS 117 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 4.0 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 469 FLPGSFHPH 495 FLP S+HPH Sbjct: 311 FLPPSYHPH 319 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 Query: 117 NCWTNTQN 140 NCWT T+N Sbjct: 240 NCWTQTEN 247 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 Query: 117 NCWTNTQN 140 NCWT T+N Sbjct: 111 NCWTQTEN 118 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 5.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 Query: 117 NCWTNTQN 140 NCWT T+N Sbjct: 240 NCWTQTEN 247 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 9 VFVLSLNFSEVPTSLN 56 +FV L ++ VP+SLN Sbjct: 76 IFVTMLRYNGVPSSLN 91 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 9 VFVLSLNFSEVPTSLN 56 +FV L ++ VP+SLN Sbjct: 76 IFVTMLRYNGVPSSLN 91 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 9 VFVLSLNFSEVPTSLN 56 +FV L ++ VP+SLN Sbjct: 76 IFVTMLRYNGVPSSLN 91 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 7.0 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +2 Query: 86 WKSNYFVKIIQLLDEYP 136 W+ F ++++LDE+P Sbjct: 862 WRHWKFPNLVEVLDEFP 878 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 Query: 477 WKKEVFSGPRPVL*AGMTTD 418 WK GP+PV G T D Sbjct: 29 WKSRGVVGPKPVPFFGTTKD 48 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 515 IEIINDVHILKPGDKVGASEATLLN 589 I I+N HIL+ K G S L+N Sbjct: 480 IGIVNQFHILQFITKNGTSNNYLIN 504 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/45 (22%), Positives = 23/45 (51%) Frame = +2 Query: 167 GSQQMQQIRISLRGHSIVLMGKNTMMRKAIKDHLETNPALEKLLP 301 G+QQ +++++L + MRK ++ T+ L +++P Sbjct: 356 GTQQSVELKLALDQEQLKSKKLEESMRKLDEEMKRTDELLYQMIP 400 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,591 Number of Sequences: 438 Number of extensions: 4069 Number of successful extensions: 16 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -