BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C11 (545 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59063| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_17878| Best HMM Match : Drf_FH1 (HMM E-Value=0.022) 29 3.3 SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) 28 5.7 SB_47264| Best HMM Match : Ion_trans (HMM E-Value=1.19951e-42) 28 5.7 SB_15869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_12341| Best HMM Match : Death (HMM E-Value=3.3e-08) 28 5.7 SB_23528| Best HMM Match : RVT_1 (HMM E-Value=0.00042) 27 7.6 >SB_59063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 31.5 bits (68), Expect = 0.46 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -2 Query: 208 SINSTLVRTTSSAARSRCTALSNRDRGLKTYWKKVS 101 S+NS + + ++ RC +S D L+TYW+KV+ Sbjct: 229 SLNSCVSCISQASRADRCLPVSRSDSILETYWRKVN 264 >SB_17878| Best HMM Match : Drf_FH1 (HMM E-Value=0.022) Length = 664 Score = 28.7 bits (61), Expect = 3.3 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +3 Query: 378 RNVDHIRXXXXXXXXVQVKCIRDIHVIFIHKGDHLFRYNAFTLTPGKS 521 RN+DHI +V+ + D ++ G+ L+ PGKS Sbjct: 3 RNIDHILTIASIITNCRVEDVPDCFRTRLYNGEDLYEIEVTKFPPGKS 50 >SB_55198| Best HMM Match : NUDE_C (HMM E-Value=0.84) Length = 649 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 112 KKVSTQLEQVSRASRVGGIRVALAFRTGFCY 20 KK+ST+ + RAS V +++ F TG CY Sbjct: 613 KKMSTRSMGLKRASSVKYVQLLYLFNTGKCY 643 >SB_47264| Best HMM Match : Ion_trans (HMM E-Value=1.19951e-42) Length = 1172 Score = 27.9 bits (59), Expect = 5.7 Identities = 20/79 (25%), Positives = 35/79 (44%) Frame = -2 Query: 247 MTNALTCSKSIASSINSTLVRTTSSAARSRCTALSNRDRGLKTYWKKVSTQLEQVSRASR 68 +TN + +KS+ + I T + T+ RSR +S + Y+K + L +S S Sbjct: 283 LTNQIRRNKSVTNQIRRTNEKVTNQIKRSR-LPISLGVTSKQPYYKGNARSLIYISGTSL 341 Query: 67 VGGIRVALAFRTGFCYLSE 11 V + V C+L + Sbjct: 342 VPPLTVRTETPNTLCFLQQ 360 >SB_15869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1420 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/58 (22%), Positives = 30/58 (51%) Frame = -1 Query: 389 VYVARMRRLNHQPFKVSIDVMSDKAVDAVVRIFIGPKYDCMGRLMSINDKRLDMLEID 216 V++A + + + +P S + + ++ IGP + +GR + +++ LD +E D Sbjct: 1097 VFIALLVKTSSEPLPKSGSSIVSRDTLMLLAREIGPAWKALGRALLLDNAELDQIEAD 1154 >SB_12341| Best HMM Match : Death (HMM E-Value=3.3e-08) Length = 194 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -1 Query: 290 IGPKYDCMGRLMSINDKRLDMLEIDSFVYKLDTGK 186 IG ++ +GR++ + D LDM++ D K + K Sbjct: 117 IGKRWKALGRVLRLKDSELDMIDEDESKLKEKSNK 151 >SB_23528| Best HMM Match : RVT_1 (HMM E-Value=0.00042) Length = 445 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/55 (23%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = -2 Query: 250 SMTNALTCSKSIASSINSTLVRTTSSAARSRCTALSNRDRGLKTYWK-KVSTQLE 89 S+ + + C +S+ ++ + L + R +C AL +D YW+ KV ++ Sbjct: 27 SLLDLVGCVRSLETASRAVLCHQAVISKRQKCLALFGKDSQQFCYWRNKVQVHIK 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,071,802 Number of Sequences: 59808 Number of extensions: 334207 Number of successful extensions: 916 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -