BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C09 (422 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.91 SB_162| Best HMM Match : Extensin_2 (HMM E-Value=0.79) 29 2.1 SB_17658| Best HMM Match : GAS2 (HMM E-Value=6.9e-09) 29 2.1 SB_13995| Best HMM Match : ASC (HMM E-Value=0.0034) 29 2.1 SB_51815| Best HMM Match : RVT_1 (HMM E-Value=0.23) 28 2.8 SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) 27 4.8 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_18957| Best HMM Match : zf-TAZ (HMM E-Value=3.7) 27 4.8 SB_46562| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_58522| Best HMM Match : Spb1_C (HMM E-Value=4) 27 8.5 SB_53911| Best HMM Match : Ald_Xan_dh_C2 (HMM E-Value=0) 27 8.5 SB_8486| Best HMM Match : Granulin (HMM E-Value=0) 27 8.5 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.9 bits (64), Expect = 0.91 Identities = 24/73 (32%), Positives = 29/73 (39%), Gaps = 1/73 (1%) Frame = +1 Query: 160 CTEAETDCPAGTHI-TAKGLCPSQQHRGVECCHSVLRKINTCRSHGGECMDRCPENLTYK 336 C+E CP K CPS ECC +VL + +SH C C E+ Sbjct: 1304 CSEHSNACPQECSTDNCKPSCPS------ECCLTVLTPLKENKSHQEGCPAVCSESC--- 1354 Query: 337 NADDCNIKNKICC 375 DC IK CC Sbjct: 1355 -KPDCPIK---CC 1363 Score = 29.1 bits (62), Expect = 1.6 Identities = 17/52 (32%), Positives = 20/52 (38%) Frame = +1 Query: 160 CTEAETDCPAGTHITAKGLCPSQQHRGVECCHSVLRKINTCRSHGGECMDRC 315 C + CPA K CP ECC +VL+ I R H C C Sbjct: 1246 CLKDARGCPATCVEDCKPGCPP------ECCFAVLKPIQENREHSQSCPKIC 1291 >SB_162| Best HMM Match : Extensin_2 (HMM E-Value=0.79) Length = 820 Score = 28.7 bits (61), Expect = 2.1 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -2 Query: 256 NDNILRPYAVDLDKDLSQ*CEYQPDSPFQLRYTSRRTHYKVVRR 125 +D L+P VD +K++++ CE Q SP RR + +R+ Sbjct: 688 SDQALKPNNVDENKNITRDCELQMKSPSATSLEDRRQEEEELRQ 731 >SB_17658| Best HMM Match : GAS2 (HMM E-Value=6.9e-09) Length = 959 Score = 28.7 bits (61), Expect = 2.1 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = -2 Query: 256 NDNILRPYAVDLDKDLSQ*CEYQPDSPFQLRYTSRRTHYKVVRR 125 +D L+P VD +K++++ CE Q SP RR + +R+ Sbjct: 827 SDQALKPNNVDENKNITRDCELQMKSPSATSLEDRRQEEEELRQ 870 >SB_13995| Best HMM Match : ASC (HMM E-Value=0.0034) Length = 610 Score = 28.7 bits (61), Expect = 2.1 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +1 Query: 262 LRKINTCRSHGG-ECMDRCPENLTYKNA 342 L ++N GG +C+++CP+ TYK A Sbjct: 104 LNRVNMMYQEGGLKCLEKCPQPCTYKFA 131 >SB_51815| Best HMM Match : RVT_1 (HMM E-Value=0.23) Length = 297 Score = 28.3 bits (60), Expect = 2.8 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +1 Query: 316 PENLTYKNADDCNIKNK-ICCIL 381 PE L +N DDC I NK + C+L Sbjct: 254 PEKLNARNRDDCEIHNKTLTCML 276 >SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 675 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 241 VECCHSVLRKINTCRSHGGECMDRC-PENLTYKNADDC 351 V C V+R++ TC + G C D PE + DC Sbjct: 578 VTCGEGVVRRVVTCSAGGNRCQDDTKPEVVKLCELPDC 615 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 27.5 bits (58), Expect = 4.8 Identities = 19/75 (25%), Positives = 28/75 (37%), Gaps = 2/75 (2%) Frame = +1 Query: 133 QPCNAFGGKCTEA--ETDCPAGTHITAKGLCPSQQHRGVECCHSVLRKINTCRSHGGECM 306 Q C + G +A + DCP + +G C + R +C + G +C Sbjct: 1573 QKCECYPGWAGDACDKLDCPGSPPCSGQGECSNTNPRRCQCFP---------KWGGEKCE 1623 Query: 307 DRCPENLTYKNADDC 351 C Y NA DC Sbjct: 1624 IPCLNGYNYGNASDC 1638 >SB_18957| Best HMM Match : zf-TAZ (HMM E-Value=3.7) Length = 117 Score = 27.5 bits (58), Expect = 4.8 Identities = 20/76 (26%), Positives = 35/76 (46%) Frame = +1 Query: 76 INQSNGVIEPSKATLVYDEQPCNAFGGKCTEAETDCPAGTHITAKGLCPSQQHRGVECCH 255 +N +I + + +V+D+Q GG+C A D +H G C + H G +C Sbjct: 11 VNGGQWLIAQAASVIVHDDQCVIVHGGQCMIAHGDRCTVSH---SGRC-TVAHGG-QCV- 64 Query: 256 SVLRKINTCRSHGGEC 303 ++ +HGG+C Sbjct: 65 -IVHGSQCVIAHGGQC 79 >SB_46562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 80 LIRKTHRKHTKNGRRKH 30 LIR THRKH KN + H Sbjct: 139 LIRSTHRKHCKNEKCTH 155 >SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 27.5 bits (58), Expect = 4.8 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 10/107 (9%) Frame = +1 Query: 88 NGVIEPSKATLVYDEQPCNAFGGKCTEAETDCPAGTHITAKGLC-PSQQHRGVECCHSVL 264 N +IE ++ DE C A GG C P +T C PSQ C V Sbjct: 436 NRIIEGNEQCDCGDENSCKAEGGCCN--PPGHPQACRLTLAATCSPSQGPCCGRDCRYVG 493 Query: 265 RKINTCRSHGGECMDR---------CPENLTYKNADDCNIKNKICCI 378 I +CR+ +C+D+ CP+++ + C+ ++C + Sbjct: 494 NDI-SCRNK-TDCLDKAMCSGSSVECPKSVYQPDNTVCDKGRRVCSV 538 >SB_58522| Best HMM Match : Spb1_C (HMM E-Value=4) Length = 299 Score = 26.6 bits (56), Expect = 8.5 Identities = 19/67 (28%), Positives = 27/67 (40%) Frame = +1 Query: 166 EAETDCPAGTHITAKGLCPSQQHRGVECCHSVLRKINTCRSHGGECMDRCPENLTYKNAD 345 E E P+ TH TA + ++ HRG H VLR +N + D ++ A Sbjct: 15 EDEASGPSDTH-TASPM-QTESHRGNGESHEVLRTLNDLNRNMASMADTLASFMSAHTAQ 72 Query: 346 DCNIKNK 366 N K Sbjct: 73 GVNASRK 79 >SB_53911| Best HMM Match : Ald_Xan_dh_C2 (HMM E-Value=0) Length = 817 Score = 26.6 bits (56), Expect = 8.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 145 AFGGKCTEAETDCPAGTH 198 +FG C+E E DC G H Sbjct: 655 SFGAACSEVEIDCLTGDH 672 >SB_8486| Best HMM Match : Granulin (HMM E-Value=0) Length = 878 Score = 26.6 bits (56), Expect = 8.5 Identities = 24/84 (28%), Positives = 30/84 (35%), Gaps = 12/84 (14%) Frame = +1 Query: 139 CNAFGGKCTEAETDCPAGTHITAKGL----CP---SQQHRGVECCHSVLRKINTCRSHGG 297 CN+ G C+E ++ P AK L CP SQ G CC + C Sbjct: 392 CNSSSGTCSEGDSVLPLFKKTPAKQLKNVVCPDETSQCPDGNTCCKLSSGQYGCCPLPNA 451 Query: 298 ECMDR----CPENLTYKNADD-CN 354 C D CP T + CN Sbjct: 452 VCCDDGVHCCPNGYTCDTSSGRCN 475 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,423,519 Number of Sequences: 59808 Number of extensions: 232247 Number of successful extensions: 614 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 614 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -