BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C09 (422 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g18050.1 68416.m02296 expressed protein 29 1.7 At5g55110.1 68418.m06870 stigma-specific Stig1 family protein si... 28 3.0 At3g07550.2 68416.m00902 F-box family protein (FBL12) contains s... 28 3.0 At3g07550.1 68416.m00901 F-box family protein (FBL12) contains s... 28 3.0 At5g18430.1 68418.m02171 GDSL-motif lipase/hydrolase family prot... 27 4.0 At3g58860.1 68416.m06560 F-box family protein contains F-box dom... 27 5.2 At5g38396.1 68418.m04641 F-box family protein contains F-box dom... 27 6.9 At3g59000.1 68416.m06576 F-box family protein contains F-box dom... 27 6.9 At3g11370.1 68416.m01382 DC1 domain-containing protein contains ... 27 6.9 At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 27 6.9 At2g40980.1 68415.m05062 expressed protein 27 6.9 At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel... 26 9.1 At1g53130.1 68414.m06016 stigma-specific Stig1 family protein si... 26 9.1 >At3g18050.1 68416.m02296 expressed protein Length = 335 Score = 28.7 bits (61), Expect = 1.7 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +1 Query: 172 ETDCPAGTHITAKGLCPSQQHRGVECCHSVLRKINTCRSHGGECMDRCPENLTYK-NADD 348 ETDC +G+H A G P G C + L K+N ++ G + N T K + D Sbjct: 193 ETDCLSGSHNNADGFSPL---LGCNKCLNSLYKLNPKKTSGTRNPSKEDRNRTAKMHNKD 249 Query: 349 C 351 C Sbjct: 250 C 250 >At5g55110.1 68418.m06870 stigma-specific Stig1 family protein similar to stigma-specific protein STIG1 [Nicotiana tabacum] GI:496647; contains Pfam profile PF04885: Stigma-specific protein, Stig1 Length = 163 Score = 27.9 bits (59), Expect = 3.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 211 GLCPSQQHRGVECCHSVLRKINTCRSHGGECMDRC 315 GLC ++ G CC + + H GEC RC Sbjct: 115 GLCKNKCKFGQTCCRGQCVYVAYDKRHCGECNHRC 149 >At3g07550.2 68416.m00902 F-box family protein (FBL12) contains similarity to F-box protein FBL6 GI:6456737 from [Homo sapiens] Length = 395 Score = 27.9 bits (59), Expect = 3.0 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 268 KINTCRSHGGECMDRCPENLTYKNADDCNIKNK 366 KI+ C+S G C L Y +AD C ++ K Sbjct: 200 KISNCKSITGVGFSGCSPTLGYVDADSCQLEPK 232 >At3g07550.1 68416.m00901 F-box family protein (FBL12) contains similarity to F-box protein FBL6 GI:6456737 from [Homo sapiens] Length = 395 Score = 27.9 bits (59), Expect = 3.0 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 268 KINTCRSHGGECMDRCPENLTYKNADDCNIKNK 366 KI+ C+S G C L Y +AD C ++ K Sbjct: 200 KISNCKSITGVGFSGCSPTLGYVDADSCQLEPK 232 >At5g18430.1 68418.m02171 GDSL-motif lipase/hydrolase family protein similar to family II lipase EXL1 GI:15054382 from [Arabidopsis thaliana]; contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase Length = 362 Score = 27.5 bits (58), Expect = 4.0 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +2 Query: 182 VRLVLTSLRKVFVQVNSIGA*NVVIQF*GKL--TPADLTAGNAWTG 313 VRL+++ +K+ +++NS+G V++ G L PA+L G Sbjct: 192 VRLLISEYKKILLRLNSLGVGRVLVTGAGPLGCAPAELARSGTSNG 237 >At3g58860.1 68416.m06560 F-box family protein contains F-box domain Pfam:PF00646 Length = 457 Score = 27.1 bits (57), Expect = 5.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 340 HFYTSGSQDTCPCIPRREIGRC*FSLKLN 254 H T+ D C CIPR++ GR + +N Sbjct: 348 HTVTNKCGDVCDCIPRKKKGRSLMACPVN 376 >At5g38396.1 68418.m04641 F-box family protein contains F-box domain Pfam:PF00646 Length = 462 Score = 26.6 bits (56), Expect = 6.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 340 HFYTSGSQDTCPCIPRREIGR 278 HF T D C C+ R E GR Sbjct: 362 HFVTDKCGDACDCVSREEKGR 382 >At3g59000.1 68416.m06576 F-box family protein contains F-box domain Pfam:PF00646 Length = 491 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 340 HFYTSGSQDTCPCIPRREIGRC*FSLKLN 254 H T D C C+PR + GR S +N Sbjct: 364 HHVTDKCGDACDCVPREDKGRSLTSCPVN 392 >At3g11370.1 68416.m01382 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 589 Score = 26.6 bits (56), Expect = 6.9 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 259 VLRKINTCRSHGGECMDRCPENLTYKNADD 348 VLR N+ R C DRCP + +K D Sbjct: 544 VLRNSNSTRPQCTRCGDRCPGYIYFKRKRD 573 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 26.6 bits (56), Expect = 6.9 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 213 TFRSDVSTSRTVRFSFGTLPA 151 TF++DVST++T+ +G L A Sbjct: 855 TFQNDVSTAKTLNLDYGDLSA 875 >At2g40980.1 68415.m05062 expressed protein Length = 617 Score = 26.6 bits (56), Expect = 6.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 241 VECCHSVLRKINTCRSHGGECMDRCPENLTY 333 + CCH L +++ S G D PEN+ Y Sbjct: 449 IRCCHDCLSALSSSSSAGIRHGDIRPENVVY 479 >At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel, putative (CNGC14) similar to cyclic nucleotide and calmodulin-regulated ion channel (GI:4581205) [Arabidopsis thaliana] Length = 726 Score = 26.2 bits (55), Expect = 9.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 112 LYWVLLPHWTD*LEKRTENIRKMEDVNTF 26 L W LLP T L T +R +E+V F Sbjct: 555 LAWALLPKSTVNLPSSTRTVRALEEVEAF 583 >At1g53130.1 68414.m06016 stigma-specific Stig1 family protein similar to stigma-specific protein STIG1 [Nicotiana tabacum] GI:496647; contains Pfam profile PF04885: Stigma-specific protein, Stig1 Length = 168 Score = 26.2 bits (55), Expect = 9.1 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 211 GLCPSQQHRGVECCHSVLRKINTCRSHGGECMDRC 315 G C + G CC V +N +H G+C +C Sbjct: 120 GRCGHKCGFGQRCCGGVCTYVNFNPNHCGKCTRKC 154 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,840,760 Number of Sequences: 28952 Number of extensions: 152994 Number of successful extensions: 370 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 655255392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -