Samia BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0005_C07
         (438 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC8E4.04 |||aldo/keto reductase involved in pentose catabolism...    27   0.96 
SPAC22E12.16c |pik1||phosphatidylinositol kinase Pik1|Schizosacc...    25   5.1  

>SPBC8E4.04 |||aldo/keto reductase involved in pentose catabolism
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 325

 Score = 27.5 bits (58), Expect = 0.96
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = -3

Query: 397 MSQTFQRSRVTAKVVWVIAFVWVLAHRAQLTVLAL 293
           + +  + S V    +WV + +W  AHRA L  LAL
Sbjct: 65  IGEGIRESGVPRTDIWVTSKLWCNAHRAGLVPLAL 99


>SPAC22E12.16c |pik1||phosphatidylinositol kinase
           Pik1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 851

 Score = 25.0 bits (52), Expect = 5.1
 Identities = 8/12 (66%), Positives = 12/12 (100%)
 Frame = +1

Query: 91  KILSHRSQQKRW 126
           KI+SH++Q+KRW
Sbjct: 361 KIVSHKNQRKRW 372


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,776,912
Number of Sequences: 5004
Number of extensions: 34175
Number of successful extensions: 84
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 82
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 84
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 158122380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)