BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C05 (391 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 25 0.41 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 0.54 EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-a... 24 0.54 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 24 0.71 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 24 0.71 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 24 0.71 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 24 0.71 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 0.71 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 3.8 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 3.8 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.41 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 92 VVHNHAARVGDFFGPVLLSHISHFYSQFTN 3 +V NH ++ + + PVL H +H +F + Sbjct: 345 IVLNHPGQISNGYTPVLDCHTAHIACKFAD 374 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 24.2 bits (50), Expect = 0.54 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -3 Query: 92 VVHNHAARVGDFFGPVLLSHISHFYSQF 9 +V NH ++ + + PVL H +H +F Sbjct: 345 IVLNHPGQISNGYTPVLDCHTAHIACKF 372 >EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-alpha protein. Length = 119 Score = 24.2 bits (50), Expect = 0.54 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -3 Query: 92 VVHNHAARVGDFFGPVLLSHISHFYSQF 9 +V NH ++ + + PVL H +H +F Sbjct: 56 IVLNHPGQISNGYTPVLDCHTAHIACKF 83 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 0.71 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +3 Query: 201 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 353 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 0.71 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +3 Query: 201 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 353 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.8 bits (49), Expect = 0.71 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +3 Query: 201 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 353 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.8 bits (49), Expect = 0.71 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +3 Query: 201 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 353 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 53 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 105 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.8 bits (49), Expect = 0.71 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +3 Query: 201 KEKYAKYLPHSAGRYAHK--RFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRI 353 + Y KY S R + R R + I+ L+N + + NN KKL I Sbjct: 286 ENSYRKYRETSKERSRDRKERERSKEPKIISSLSNKTIHNNNNNYKKLQYYNI 338 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.4 bits (43), Expect = 3.8 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -2 Query: 276 GTELYGIVCERTCQQNVVNILHTSLL 199 G + GI+C++T + ++LH +L Sbjct: 94 GELVMGILCKKTLGTSAGSLLHICML 119 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 3.8 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 200 YRNIILQRHVRYLNVITTPSPKKFDFGN 117 Y N L ++ Y+ I P P +GN Sbjct: 321 YNNKKLYYNINYIEQIPVPVPVPIYYGN 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,892 Number of Sequences: 438 Number of extensions: 2294 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9514659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -