BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_C03 (601 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g40200.1 68418.m04878 DegP protease, putative contains simila... 29 3.1 At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly... 29 3.1 At4g22320.1 68417.m03227 expressed protein 28 5.4 At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to... 28 5.4 At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase fa... 28 5.4 At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CH... 27 7.2 At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CH... 27 7.2 At5g27230.1 68418.m03248 expressed protein ; expression support... 27 9.5 >At5g40200.1 68418.m04878 DegP protease, putative contains similarity to DegP2 protease GI:13172275 from [Arabidopsis thaliana] Length = 592 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 159 NVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRI 269 N +DEY K DYD +D T K+A + L + I Sbjct: 542 NCEDEYMKFNLDYDQIVVLDTKTAKEATLDILTTHCI 578 >At2g24210.1 68415.m02892 myrcene/ocimene synthase (TPS10) nearly identical to GI:9957293; contains Pfam profile: PF01397 terpene synthase family Length = 591 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 2/69 (2%) Frame = +3 Query: 111 ERQKKVLSLFQD--VDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLKLYRIGYLPK 284 E+ +K+L+ Q +DQ+ D+ K+G Y EA IDN ++ + Sbjct: 82 EKVRKMLNDEQKTYLDQLEFIDDLQKLGVSYHFEAEIDNILTSSYKKDRTNIQESDLHAT 141 Query: 285 YYEFSIFYQ 311 EF +F Q Sbjct: 142 ALEFRLFRQ 150 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 87 KDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEE 248 K V +E QKK ++ ++ D++ DD KI +D VE D K VEE Sbjct: 115 KYVPIAVLEEQKKEITEIEEDDKIEEDD---KIDEDNKVEQE-DKVDEDKTVEE 164 >At4g01440.1 68417.m00185 nodulin MtN21 family protein similar to MtN21 GI:2598575 (root nodule development) from [Medicago truncatula] Length = 365 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +3 Query: 36 ALVQSSVVSPKTYHFKTKDVDAVFVERQKKVLSLFQDVDQVNVDDEYYKIG 188 ++V S VV Y F V + E +KK+ F + DQ DDE YK G Sbjct: 306 SVVGSGVVIFGLYIFLLGKVRLMKEECEKKLPCRFNEDDQEEDDDEQYKKG 356 >At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|Q9Y2Q0, SP|O43520]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1228 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -3 Query: 398 SESGTLVEG-FKVFSIVEQVEKSNSLFP*LLVEDGELIVLGKITDSVQFQ 252 S SG ++E +KV +++E K + + E+G++++L K DS+ F+ Sbjct: 595 SGSGQIIEREYKVLNLLEFTSKRKRMTVIVRDEEGQILLLCKGADSIIFE 644 >At5g41610.2 68418.m05055 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 742 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 293 LIVLGKITDSVQFQEFFNSFLIGVVI 216 ++V G ITD++ F +F++GV+I Sbjct: 204 VLVCGFITDAIGIHSMFGAFVVGVLI 229 >At5g41610.1 68418.m05056 cation/hydrogen exchanger, putative (CHX18) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 810 Score = 27.5 bits (58), Expect = 7.2 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 293 LIVLGKITDSVQFQEFFNSFLIGVVI 216 ++V G ITD++ F +F++GV+I Sbjct: 272 VLVCGFITDAIGIHSMFGAFVVGVLI 297 >At5g27230.1 68418.m03248 expressed protein ; expression supported by MPSS Length = 948 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +3 Query: 93 VDAVFVERQKKVLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVEEFLK 257 V A+ +E+++K L L + + E+ K KD+D+E + K+ VE+ K Sbjct: 69 VKALELEKKEKELCLIDESMKAK-QSEFEKKEKDFDLEQKAEVEKRKREVEQLEK 122 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,378,566 Number of Sequences: 28952 Number of extensions: 245485 Number of successful extensions: 639 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -