BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B24 (555 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0345 - 3811057-3811236,3811342-3811615,3811732-3812289,381... 32 0.35 09_06_0076 + 20710482-20710670,20711313-20711547,20711664-207116... 28 4.4 03_05_0449 - 24437994-24438157,24438265-24438383,24438489-24438760 28 4.4 05_01_0536 - 4622767-4622865,4623550-4623673,4624571-4624685,462... 28 5.8 02_01_0451 - 3237849-3238061,3238142-3238268,3238418-3238656,323... 28 5.8 12_02_1157 + 26565040-26565081,26565189-26565262,26565343-265654... 27 7.6 06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905,581... 27 7.6 01_06_0946 + 33220910-33222221,33223373-33223734,33223863-332240... 27 7.6 >10_01_0345 - 3811057-3811236,3811342-3811615,3811732-3812289, 3812602-3812747,3812930-3813097,3813896-3814003, 3814859-3815029,3816557-3816949,3817522-3817617, 3817715-3817774,3818600-3818744,3819296-3819520, 3820106-3820254 Length = 890 Score = 31.9 bits (69), Expect = 0.35 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +1 Query: 145 LCGGSLISSKYVLTAAHCVTGAILIEGTPKNVRLGEYNTTNNGPDCMK 288 +C + +Y + A C L+E P+ + G+Y +T PDC K Sbjct: 416 VCSQLFTTHQYTFSIACCFCNDYLLETRPERLGQGQYKSTLVCPDCKK 463 >09_06_0076 + 20710482-20710670,20711313-20711547,20711664-20711689, 20712000-20712293,20712603-20712728,20712827-20712896, 20712992-20713182,20713394-20713519,20713878-20714279, 20714364-20714758,20714861-20715315,20715403-20715524, 20715653-20715693,20716026-20716129,20716363-20716576, 20717667-20717780,20718576-20718612 Length = 1046 Score = 28.3 bits (60), Expect = 4.4 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Frame = -2 Query: 506 LATYISKSAGGCCV*SKDGKQMGRTKSVYGAVTISLISAMSCLPC-TSLGM*SGCGIVFS 330 + ++ + GG V +K GK+ GR ++ + +A CLPC TSL S Sbjct: 894 ITVFVVEKTGGLRVFTKYGKEYGR-NAIQVLFDGCMKAASGCLPCKTSLPRESASAWWTQ 952 Query: 329 IGAVT-TGCAQS 297 + V+ GC +S Sbjct: 953 VDTVSGQGCGES 964 >03_05_0449 - 24437994-24438157,24438265-24438383,24438489-24438760 Length = 184 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/69 (24%), Positives = 27/69 (39%) Frame = -2 Query: 344 GIVFSIGAVTTGCAQSLVPFMQSGPLFVVLYSPKRTFFGVPSIKIAPVTQCAAVSTYFEL 165 G + ++ A T + +P L + Y + VPS I C V F Sbjct: 58 GSITTVIATTVYLVWAYMPERCLRSLGITYYPSRYWALAVPSFVIVATALCMVVYVGFNF 117 Query: 164 MSEPPHSSF 138 ++ PP +SF Sbjct: 118 LATPPPTSF 126 >05_01_0536 - 4622767-4622865,4623550-4623673,4624571-4624685, 4624784-4625028,4625081-4625316 Length = 272 Score = 27.9 bits (59), Expect = 5.8 Identities = 17/62 (27%), Positives = 30/62 (48%) Frame = -1 Query: 369 IVGDVIWMWNSFFYRSSNNGMCTVFGTFHAVRTIVCCIILS*THILRRSFNQDCSSDTVC 190 +VGDV W ++ F +S G C FG+F + ++ + LR +QD ++ Sbjct: 192 LVGDVPWKYSKFLEINSIPGSCH-FGSFCCIFALIISRLNKPFLFLRTDKHQDLLDESQI 250 Query: 189 SS 184 S+ Sbjct: 251 SA 252 >02_01_0451 - 3237849-3238061,3238142-3238268,3238418-3238656, 3238937-3239151,3239569-3240031,3240562-3240715, 3241724-3241833,3242540-3242797,3242843-3242854, 3243492-3243545,3244202-3244312,3244390-3244545, 3244798-3245201,3245405-3245501,3246041-3246050, 3246097-3246164,3246652-3246762,3246874-3247074, 3247384-3247485,3247980-3248087,3248209-3248411, 3248563-3248680,3248774-3248854,3248958-3249500, 3249602-3249730 Length = 1428 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +1 Query: 292 TKDCAHPVVTAPIEKTIPHPDYIPNDVQGRHDIALI 399 TK C V TAPI KTI + Y D G+ D+ L+ Sbjct: 427 TKHCTRAVYTAPI-KTISNQKY--RDFCGKFDVGLL 459 >12_02_1157 + 26565040-26565081,26565189-26565262,26565343-26565460, 26565547-26565617,26565704-26565869,26565946-26566145, 26566669-26566880,26567404-26567522,26567952-26568053, 26568144-26568253,26568340-26568427,26568574-26568606, 26568635-26568834,26568916-26569120 Length = 579 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -2 Query: 554 VLDKPVPDMN-CLYIPXLATYISKS 483 VL PVP N CL+IP +A Y SK+ Sbjct: 418 VLYSPVPFQNGCLHIPEVALYNSKA 442 >06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905, 5819969-5820064,5820147-5820266,5820401-5820663, 5821507-5821617 Length = 363 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 141 AAMRW-LTHQFEVRAHCCTLC 200 AA+RW LTH E A CC C Sbjct: 264 AAVRWGLTHHKESAADCCQAC 284 >01_06_0946 + 33220910-33222221,33223373-33223734,33223863-33224073, 33224174-33224411,33224492-33224642,33224733-33224997, 33231775-33231820,33232167-33232815,33232883-33233384, 33235023-33235360,33235466-33235676,33235769-33235992, 33236042-33236115,33236147-33236234,33236316-33236612 Length = 1655 Score = 27.5 bits (58), Expect = 7.6 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 76 DTKITQYPWLVVIEYESFDHMKLLCGGSLISSKYVLTAAHCVTGAIL-IEGTPKN 237 D + +Y WL+ E S D + L GGS S+ + C+ A+L +E P+N Sbjct: 752 DLNLLRYSWLLWKEGRSVDLLDQLLGGSFDYSEVL----RCIQVALLCVEVQPRN 802 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,779,576 Number of Sequences: 37544 Number of extensions: 403886 Number of successful extensions: 955 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1257681096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -