BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B21 (626 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 22 5.6 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 7.4 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 7.4 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 9.8 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 21.8 bits (44), Expect = 5.6 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 2 VHVSFAYIVNSHIKQNEIHKCVAVGDPWGVCVRAHCHTAAI 124 V + Y V H ++ + A+GD +GV + H T I Sbjct: 99 VRSAIKYWVERH--KHIVRLVTAIGDAYGVALLLHMLTTTI 137 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 7.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 157 RMPEPRLEFIQH 192 R PEP +E I+H Sbjct: 490 RQPEPLIELIEH 501 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 624 LSHSNIPLAFNLGTYVSRHP 565 L+HS+ P A +G HP Sbjct: 448 LAHSSYPAAIQIGHTPHHHP 467 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/30 (30%), Positives = 11/30 (36%) Frame = -1 Query: 623 CLTRTFLLPLTXEHTFLGTRIRHDVVETGR 534 C + F L I HDV TG+ Sbjct: 155 CSPKLFAFDLNTSQLLKQVEIPHDVATTGK 184 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,456 Number of Sequences: 438 Number of extensions: 4331 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -