BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0005_B20 (512 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2F5W3 Cluster: Serine protease inhibitor serpin; n=4; ... 87 3e-16 UniRef50_Q7RZN5 Cluster: Predicted protein; n=1; Neurospora cras... 37 0.23 UniRef50_Q1FFW3 Cluster: Serine-type D-Ala-D-Ala carboxypeptidas... 32 6.7 >UniRef50_Q2F5W3 Cluster: Serine protease inhibitor serpin; n=4; Ditrysia|Rep: Serine protease inhibitor serpin - Bombyx mori (Silk moth) Length = 458 Score = 86.6 bits (205), Expect = 3e-16 Identities = 45/96 (46%), Positives = 58/96 (60%) Frame = +3 Query: 222 MSTAMWSLFFIVQILLNVSGHSVLDPDTLKDVFGEQDQKYNSPFXXXXXXXXXXXXXXTP 401 M + ++ FF QILL S + +DP+TL+DVFG YN P TP Sbjct: 1 MISIVYITFFAAQILLCSSATANIDPNTLRDVFG-YGSTYN-PIGAVATETYRQVVAVTP 58 Query: 402 DNATLVDPDYWDLDVFEPTIADYDKFDLTLTKRISS 509 N TLVDPDYWDLD F P+ A++DKFD TLTKR+++ Sbjct: 59 YNETLVDPDYWDLDEFHPSAANFDKFDWTLTKRVAA 94 >UniRef50_Q7RZN5 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 578 Score = 37.1 bits (82), Expect = 0.23 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 4/43 (9%) Frame = -3 Query: 435 PSSQDQQGLHYPE*QPLLEQRIPPPL----VQTGCCTSDLAPR 319 P +Q G+ P QPLL QR+PPP+ +Q+G T DLA R Sbjct: 182 PPAQPTTGMVAPSSQPLLGQRLPPPVTAGPLQSGSLTRDLAGR 224 >UniRef50_Q1FFW3 Cluster: Serine-type D-Ala-D-Ala carboxypeptidase precursor; n=2; Clostridiales|Rep: Serine-type D-Ala-D-Ala carboxypeptidase precursor - Clostridium phytofermentans ISDg Length = 450 Score = 32.3 bits (70), Expect = 6.7 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 374 GFRRHWYKRAVVLLILL 324 GF+ HWYK+AV LLI+L Sbjct: 3 GFKYHWYKKAVALLIVL 19 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 450,286,394 Number of Sequences: 1657284 Number of extensions: 7813151 Number of successful extensions: 15495 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15182 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15491 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 31364627325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -